Content

Antonio Vera

Von der 'Polizei der Demokratie' zum 'Glied und Werkzeug der nationalsozialistischen Gemeinschaft'

Die Polizei als Instrument staatlicher Herrschaft im Deutschland der Zwischenkriegszeit (1918-1939)

1. Edition 2019, ISBN print: 978-3-8487-5622-3, ISBN online: 978-3-8452-9797-2, https://doi.org/10.5771/9783845297972

Series: Sicherheit. Polizeiwissenschaft und Sicherheitsforschung im Kontext, vol. 9

Bibliographic information
Nomos Antonio Vera Sicherheit. Polizeiwissenschaft und Sicherheitsforschung im Kontext | 9 Von der ‚Polizei der Demokratie‘ zum ‚Glied und Werkzeug der nationalsozialistischen Gemeinschaft‘ Die Polizei als Instrument staatlicher Herrschaft im Deutschland der Zwischenkriegszeit (1918 –1939) Sicherheit. Polizeiwissenschaft und Sicherheitsforschung im Kontext Herausgegeben von Prof. Dr. Andrea Fischbach Prof. Dr. Thomas Görgen Prof. Dr. Joachim Kersten Prof. Dr. Ralf Kölbel Prof. Dr. Dieter Kugelmann Prof. Dr. Rolf Ritsert Prof. Dr. Antonio Vera Band 9 BUT_Vera_5622-3.indd 2 17.01.19 10:37 Die Polizei als Instrument staatlicher Herrschaft im Deutschland der Zwischenkriegszeit (1918 –1939) Von der ‚Polizei der Demokratie‘ zum ‚Glied und Werkzeug der nationalsozialistischen Gemeinschaft‘ Nomos Antonio Vera BUT_Vera_5622-3.indd 3 17.01.19 10:37 © Titelbild: tmeks – istockphoto.com Die Deutsche Nationalbibliothek verzeichnet diese Publikation in der Deutschen Nationalbibliografie; detaillierte bibliografische Daten sind im Internet über http://dnb.d-nb.de abrufbar. Zugl.: Hagen, FernUniv., Diss., 2018 ISBN 978-3-8487-5622-3 (Print) ISBN 978-3-8452-9797-2 (ePDF) 1. Auflage 2019 © Nomos Verlagsgesellschaft, Baden-Baden 2019. Gedruckt in Deutschland. Alle Rechte, auch die des Nachdrucks von Auszügen, der fotomechanischen Wiedergabe und der Übersetzung, vorbehalten. Gedruckt auf alterungsbeständigem Papier. BUT_Vera_5622-3.indd 4 17.01.19 10:37 Vorwort Die vorliegende Arbeit, die im Jahr 2018 von der Fakultät für Kultur- und Sozialwissenschaften der FernUniversität in Hagen als Dissertation im Fach Geschichte angenommen worden ist, beschäftigt sich mit der Rolle, Funktion und Bedeutung der deutschen Polizei in der Zwischenkriegszeit. Diese 21 Jahre zwischen dem Ende des Ersten und der Beginn des Zweiten Weltkriegs, zwischen der Ausrufung der Republik am 9. November 1918 und dem Angriff der Wehrmacht auf Polen am 1. September 1939 stellen aus historischer und insbesondere aus polizeihistorischer Perspektive zweifelsohne eine der interessanteste Phasen der deutschen Geschichte dar. Die turbulenten, widersprüchlichen, von Gewalt, gesellschaftlichen und kulturellen Umbrüchen sowie ökonomischen und politischen Krisen geprägten Weimarer Jahre, das Scheitern der Republik und die anschließende nationalsozialistische Durchdringung aller Gesellschaftsbereiche mit ihren katastrophalen Folgewirkungen hatten derart viele und massive Implikationen für die damalige Polizei und bieten ein derart hohes Forschungspotenzial für Historiker, dass die Motive, mehrere Jahre meines Lebens dieser Dissertation zu widmen, ziemlich offensichtlich sind und daher auch keiner weiteren Erläuterung bedürfen. Gleichwohl möchte ich betonen, dass es mir aber auch ein besonderes Anliegen war, die zentrale Funktion der Polizei als Instrument staatlicher Herrschaft in den Analysefokus zu rücken, da diese herrschafts- und polizeisoziologische Erkenntnis meiner Meinung nach nicht die ihr gebührende Aufmerksamkeit erhält. Polizeidefinitionen, die sich auf ihre Rolle als Sicherheitsorgan, ‚Freund und Helfer‘ des Bürgers oder ‚Gesetzeshüter‘ konzentrieren, können manchmal irreführend sein und unrealistische Erwartungshaltungen auf Seiten des Bürgers, aber auch der Polizeibeamten entstehen lassen. Ein Großteil der Interaktionen zwischen der Polizei und der Bevölkerung sind eben nicht ‚freundlicher‘ Natur, und ihr Handeln trägt oftmals kaum oder gar nicht zur Verbesserung der Sicherheit des Bürgers bei – und das ist auch gut so. Die stärkere Berücksichtigung der Funktion der Polizei als staatliches Herrschaftsinstrument ist entscheidend, um polizeiliches Handeln, aber auch die damit zusammenhängenden politischen und gesellschaftlichen Prozesse besser zu verstehen. Dies wird in der vorliegenden Dissertation im Kontext der Weimarer Republik und der nationalsozialistischen Diktatur untersucht, es gilt aber beispielsweise auch 5 im Hinblick auf Analysen der Schwierigkeiten beim ‚nation building‘ in Afghanistan oder der katastrophalen Sicherheitslage in Mexiko. Und auch die separatistischen Bestrebungen Kataloniens sind in hohem Maß auf die Existenz einer katalanischen Polizei, die nicht von der spanischen Zentralregierung kontrolliert wird, zurückzuführen. Angesichts der offensichtlichen aktuellen Relevanz der Funktion der Polizei als Instrument staatlicher Herrschaft sind politik- und sozialwissenschaftliche Studien in diesem Themenfeld nicht nur sinnvoll, sondern meiner Meinung nach sogar dringend geboten. Ich hoffe, dass diese Dissertation daher auch außerhalb der Geschichtswissenschaft wahrgenommen wird. In einem solchen Vorwort bedankt man sich normalerweise bei allen Personen, die einen bei der langjährigen Erstellung der Dissertation unterstützt haben. In meinem Fall ist das eine sehr übersichtliche Anzahl an Menschen, die ich völlig problemlos hier abschließend anführen kann. Dazu zählt selbstverständlich und an erster Stelle mein Doktorvater, Prof. Dr. Wolfgang Kruse, der meine Dissertation sehr kompetent und effektiv betreut und daher maßgeblich zu ihrem Gelingen beigetragen hat. Danken möchte ich aber auch Prof. Dr. Alexandra Przyrembel für die Übernahme des Zweitgutachtens und Frau Doris Kock für ihre Unterstützung bei meinen Recherchen in der Polizeihistorischen Sammlung der Deutschen Hochschule der Polizei. Hervorheben möchte ich schließlich meine Ehefrau Judith, die in den letzten Jahren einen Großteil meiner väterlichen Pflichten mit übernommen hat, sowie meine Kinder Stella, Antonio, Lola und Diego, die mich in dieser Zeit nur unwesentlich vom Arbeiten abgehalten haben, so dass auch ihnen mein Dank gebührt. Münster, Januar 2019 Antonio Vera Vorwort 6 Inhaltsverzeichnis Abkürzungsverzeichnis 11 EinleitungI. 13 Forschungsstand1. 16 Forschungsansatz und Quellen2. 23 Theoretische GrundlagenII. 41 Der Polizeibegriff1. 41 Begriffsgeschichtea) 41 Modernes Begriffsverständnisb) 45 Herrschaftssoziologische Grundlagen2. 50 Staat, Macht und Herrschafta) 51 Staatliche Herrschaft als institutionalisierte Machtb) 53 Staatliche Herrschaft als soziale Praxisc) 55 Polizeisoziologische Grundlagen3. 57 Der modernisierungstheoretische Ansatza) 60 Der konflikttheoretische Ansatzb) 62 Der herrschaftstheoretische Ansatzc) 65 Der dramaturgische Ansatzd) 68 Der organisationskulturelle Ansatze) 72 Historische GrundlagenIII. 78 Geschichte der Polizei1. 78 Das Altertuma) 80 Das Mittelalterb) 86 Die Frühe Neuzeitc) 89 Das Zeitalter der Revolution und des Kapitalsd) 91 Das Deutsche Kaiserreiche) 96 Die deutsche Zwischenkriegszeit und ihre Sicherheitslage2. 101 Gründung der Weimarer Republik (1918-23)a) 104 Relative Stabilisierung der Republik (1924-29)b) 119 Späte Krisenjahre und Untergang der Republik (1930-32)c) 126 7 Nationalsozialistische Herrschaft (1933-39)d) 133 Kriminalität im Deutschland der Zwischenkriegszeit3. 154 Die deutsche Polizei in der ZwischenkriegszeitIV. 167 Zusammenbruch und Neuaufbau (1918-23)1. 168 Zusammenbruch des Wilhelminischen Polizeisystemsa) 169 Erste polizeiliche Strukturenb) 185 Einrichtung einer Einheitspolizeic) 196 Akzeptanzdefizite des polizeilichen Streifendienstesd) 205 Kriminalpolizei in der Krisee) 221 Erfolgreiche Bewältigung polizeilicher Großlagenf) 234 Modernisierung, Demokratisierung und Professionalisierung (1924-29) 2. 251 Technisch-wissenschaftliche Innovationena) 252 Spezialisierung und Zentralisierungb) 270 Ökonomisierungc) 280 Demokratisierung ‚von oben‘d) 286 Reform des Ausbildungswesense) 310 Verbesserung der Anstellungs- und Versorgungsbedingungen f) 330 Imageoffensive des Streifendienstesg) 339 Zivilisierungstendenzen bei polizeilichen Großlagenh) 355 Stagnation und Kapitulation (1930-32)3. 379 Überlastung durch politische Gewalta) 380 Mangelnder gesellschaftlicher Rückhaltb) 397 Zermürbung durch Sparmaßnahmen und politische Agitation c) 402 Resignation und Schweigend) 419 Entgrenzung und Ideologisierung (1933-39)4. 434 Übernahme der Polizeigewalta) 435 Ausweitung der Polizeibefugnisseb) 451 Neuorganisationc) 461 Organisationskulturelle Vereinnahmungd) 484 Ideologische Durchdringung der Polizeiarbeite) 505 Großlagen als Routineeinsätze und Propagandamaßnahmen f) 536 Inhaltsverzeichnis 8 Zusammenfassung und FazitV. 560 Literatur- und Quellenverzeichnis 589 Literatur1. 589 Quellen2. 615 Verwendete Zeitschrifta) 615 Einzelquellenb) 616 Inhaltsverzeichnis 9 Abkürzungsverzeichnis a. D. außer Dienst Abb. Abbildung AD Anno Domini ADGB Allgemeiner Deutscher Gewerkschaftsbund Art. Artikel Aufl. Auflage Bd. Band BDK Bund Deutscher Kriminalbeamter d. I. des Innern d. J. dieses Jahres DDP Deutsche Demokratische Partei DDR Deutsche Demokratische Republik DNVP Deutschnationale Volkspartei DVFP Deutschvölkische Freiheitspartei DVP Deutsche Volkspartei e. V. eingetragener Verein GdP Gewerkschaft der Polizei gem. gemäß Gestapo Geheime Staatspolizei gf. Hrsg. geschäftsführender Herausgeber Hrsg. Herausgeber KDP Kameradschaftsbund Deutscher Polizeibeamter e. V. KPD Kommunistische Partei Deutschlands M. d. I. Ministerium des Innern m. E. meines Erachtens m. w. N. mit weiteren Nachweisen Mrd. Milliarden NS Nationalsozialismus, Nationalsozialisten (z. B. in NS-Führung) NSDAP Nationalsozialistische Deutsche Arbeiterpartei NSKK Nationalsozialistisches Kraftfahrkorps o. S. ohne Seitenangabe/-zahl o. T. ohne Titel o. V. ohne Verfasser Orpo Ordnungspolizei PrALR Allgemeines Landrecht für die Preußischen Staaten preuß. preußisch PromO Promotionsordnung PVG Polizeiverwaltungsgesetz RFB Roter Frontkämpferbund (der KPD) 11 RStrGB Reichsstrafgesetzbuch Runderl. Runderlass RV (Weimarer) Reichsverfassung SA Sturmabteilung (der NSDAP) SD Sicherheitsdienst des Reichsführers-SS sic sic erat scriptum (so stand es geschrieben) Sipo Sicherheitspolizei SPD Sozialdemokratische Partei Deutschlands SS Schutz-Staffel (der NSDAP) StGB Strafgesetzbuch StPO Strafprozessordnung USA United States of America (Vereinigte Staaten von Amerika) USPD Unabhängige Sozialdemokratische Partei Deutschlands v. Chr. vor Christus ZDPol Zeitschrift ‚Die Polizei‘ Abkürzungsverzeichnis 12 Einleitung Aus polizeihistorischer Perspektive ist das Europa der ersten Hälfte des 20. Jahrhunderts eine äußerst interessante Periode. Zum einen sahen sich die Sicherheitsbehörden der damaligen europäischen Staaten bei der Aufrechterhaltung der öffentlichen Sicherheit und Ordnung mit enormen und neuartigen Herausforderungen konfrontiert, die insbesondere auf innen- wie außenpolitische Spannungen in nahezu allen europäischen Staaten, die Entstehung von gut organisierten, gewaltbereiten Massenbewegungen im linken wie rechten politischen Lager, politische Umsturzversuche und Revolutionen, ökonomische Krisen sowie nicht zuletzt zwei Weltkriege zurückzuführen waren.1 Zum anderen stellte die Entstehung von mehreren totalitären, auf die vollständige Auslöschung der politischen Gegner abzielenden Diktaturen in Europa die Legitimation des staatlichen Gewaltmonopols im Inneren grundsätzlich in Frage.2 Die deutsche Polizei erscheint in diesem Zusammenhang als überaus interessantes Forschungsobjekt, da sie in der ersten Hälfte des 20. Jahrhunderts mit sechs unterschiedlichen Regierungs- und Herrschaftsformen und dabei mit „höchst gegensätzlichen institutionellen Strukturen“3 im Bereich der inneren Sicherheit konfrontiert wurde: von (1) der Monarchie im Wilhelminischen Kaiserreich über (2) die Demokratie der Weimarer Republik, (3) die nationalsozialistische Diktatur im Dritten Reich und (4) die Fremdherrschaft während der Besatzungszeit bis schließlich erneut zur (5) Demokratie in der Bundesrepublik Deutschland bzw. (6) realsozialistischen Diktatur in der Deutschen Demokratischen Republik (DDR). Insofern erscheint es naheliegend, dass I. 1 Vgl. G. Blaney, Jr., Introduction: Policing Interwar Europe, in: G. Blaney, Jr. [Hrsg.], Policing Interwar Europe: Continuity, Change and Crisis, 1918-40, Houndmills u. a., 2007, S. 1ff.; C. Emsley, Police Forces and Public Order in England and France During the Interwar Years, in: C. Emsley, B. Weinberger [Hrsg.], Policing Western Europe – Politics, Professionalism and Public Order, 1850-1940, New York u. a. 1991, S. 159. 2 Vgl. H.-H. Liang, The Rise of Modern Police and the European State System from Metternich to the Second World War, Cambridge u. a. 1992, S. 2; D. Schmidt, Schützen und Dienen – Polizisten im Ruhrgebiet in Demokratie und Diktatur 1919-1939, Essen 2008, S. 15ff. 3 H.-J. Lange, Einleitung, in: H.-J. Lange [Hrsg.], Die Polizei der Gesellschaft – Zur Soziologie der Inneren Sicherheit, Opladen 2003, S. 11. 13 eine wissenschaftliche Auseinandersetzung mit diesem Themenfeld wichtige und interessante Erkenntnisse liefern könnte, um die Rolle der Polizei und ihr Handeln in der Gesellschaft besser verstehen zu können. Ein besonders ergiebiges Forschungsfeld ist in diesem Zusammenhang die deutsche Zwischenkriegszeit4, die mit der Ausrufung der (Weimarer) Republik am 9. November 1918 begann und bis zu ihrem Ende – dem deutschen Überfall auf Polen am 1. September 1939, der den Beginn des Zweiten Weltkriegs markiert – nahezu durchgängig von sozialen Unruhen und politischer Gewalt geprägt war.5 So waren die Anfangsjahre der Weimarer Republik von bürgerkriegsähnlichen Zuständen geprägt, die Richard J. Evans als „collapse of the state monopoly of violence“6 bezeichnet. Die deutsche Polizei hatte „in den Szenerien des inneren Kriegszustands der Republik Tumulte und Gewalteskalationen gleichsam zwischen den Fronten mitauszufechten“7. Ihre prekäre gesellschaftliche Rolle in diesen turbulenten Anfangsjahren der Republik wird anschaulich von Sara F. Hall ausgedrückt, die die Weimarer Polizei als „lightning rod“8 für die Spannungen und Konflikte zwischen einer traumatisierten und desorientierten Bevölkerung und der neuen Staatsgewalt bezeichnet. Die Tatsache, dass die Sicherheitslage in der Weimarer Republik selbst in den relativ stabilen Jahren ab 1924 äußerst angespannt blieb und „politische Gewalt [...] zu einem ubiquitären Phänomen“9 wurde, muss als Indiz gedeutet werden, dass die Weimarer Polizei den neuartigen Herausforderungen dieser Zeit möglicherweise nicht gewachsen war. Besonders deutlich wurde dies, als sie in der ab 1930 einsetzenden, rasch eskalierenden, von massiver politischer Gewalt getriebenen Staatskrise immer öfter mit der Aufrechterhaltung der öffentlichen Ordnung und Sicher- 4 Zur Zwischenkriegszeit als Epoche vgl. H. Möller, Europa zwischen den Weltkriegen, München 1998, S. 1ff. und S. 117ff. 5 Vgl. D. Schumann, Politische Gewalt in der Weimarer Republik 1918-1933 – Kampf um die Straße und Furcht vor dem Bürgerkrieg, Essen 2001, S. 11 D. Schumann, Europa, der Erste Weltkrieg und die Nachkriegszeit: eine Kontinuität der Gewalt? in: Journal of Modern European History, 1. Jg. (2003), Nr. 1, S. 24ff. 6 R. J. Evans, Rereading German History 1800-1996 – From Unification to Reunification, London u. a. 2003, S. 75. 7 P. Leßmann-Faust, Die Preußische Schutzpolizei in der Weimarer Republik – Streifendienst und Straßenkampf, Frankfurt a. M. 2012 (Erstveröffentlichung: 1989), S. 7. 8 S. F. Hall, Nurturing the New Republic – The Contested Feminization of Law Enforcement in Weimar Culture, in: K. Mladek [Hrsg.], Police Forces – A Cultural History of the Police, New York u. a. 2007, S. 77. 9 Vgl. Schumann, Politische Gewalt, S. 228ff. (Zitat: S. 228). I. Einleitung 14 heit überfordert war, immer seltener gegen nationalsozialistische Gewalttaten vorging, oftmals sogar die Übernahme von Polizeifunktionen durch die Sturmabteilung (SA) der Nationalsozialistischen Deutschen Arbeiterpartei (NSDAP) tolerierte und damit ihre Funktion als zentraler Träger des staatlichen Gewaltmonopols im Inneren zumindest teilweise einbüßte.10 Nach der Machtübernahme durch die Nationalsozialisten im Jahr 1933 zeigte sich dann, dass die deutschen Polizeibeamten dem neuen Regime „nicht nur passiv, sondern mehrheitlich wohlwollend zur Seite standen“11. Die von den neuen Machthabern in der Folgezeit beschlossene, massive Ausweitung der polizeilichen Zugriffskompetenzen, die nach Ansicht von Peter Nitschke nahezu auf eine „Gleichsetzung von Willkür und Recht“12 hinauslief, verstärkte die ohnehin vorhandene, nicht unerhebliche Identifikation und Assoziation der meisten Polizeibeamten mit dem nationalsozialistischen Regime noch weiter. Dies setzte einen Prozess der zunehmenden Brutalisierung und ‚Entzivilisierung‘ des polizeilichen Handelns in Gang, der dann während des Zweiten Weltkriegs in der engagierten und effizienten Beteiligung der Polizei am Vernichtungskrieg im Osten und am Holocaust als „Handlanger des Völkermords“13 mündete.14 Gerade dieser drastische Wandel der gesellschaftlichen Rolle der Polizei sowie des polizeilichen Selbstverständnisses von einer „Polizei der Demokratie“15, wie sie im April 1919 in der Zeitschrift ‚Die Polizei‘ gefordert wurde, zu ihrer im August 1938 in derselben Zeitschrift festgehaltenen Funktion als „Glied und Werkzeug der nationalsozialistischen Gemein- 10 Vgl. E. D. Kohler, The Crisis in the Prussian Schutzpolizei 1930-32, in: G. L. Mosse [Hrsg.], Police Forces in History, London, Beverly Hills 1975, S. 149; R. Bessel, Policing, Professionalisation and Politics in Weimar Germany, in: C. Emsley, B. Weinberger, Barbara [Hrsg.], Policing Western Europe – Politics, Professionalism and Public Order, 1850-1940, New York u. a. 1991, S. 202 f.; Schumann, Politische Gewalt, S. 306ff.; Leßmann-Faust, Die Preußische Schutzpolizei, S. 314ff. und insb. S. 320ff.; P. Leßmann-Faust, Geschichte der Polizei, in: M. Kniesel, E. Kube, M. Murck [Hrsg.], Handbuch für Führungskräfte der Polizei – Wissenschaft und Praxis, Lübeck 1996, S. 25. 11 P. Nitschke, Polizei im NS-System, in: H.-J. Lange [Hrsg.], Staat, Demokratie und Innere Sicherheit, Opladen 2000, S. 56. 12 Nitschke, Polizei im NS-System, S. 62. 13 D. J. Goldhagen, Hitlers willige Vollstrecker – Ganz gewöhnliche Deutsche und der Holocaust, München 2012 (Erstveröffentlichung: 1996), S. 219. 14 Vgl. Leßmann-Faust, Geschichte der Polizei, S. 26ff.; Nitschke, Polizei im NS- System, S. 56ff. 15 H. Eiben, Die Polizei der Demokratie, in: ZDPol, 16. Jg. (1919/20), Nr. 1 (10.4.1919), S. 9. I. Einleitung 15 schaft“16, verdeutlicht, dass eine fundierte historische Analyse der deutschen Polizei in der Zwischenkriegszeit geeignet ist, grundlegende und wertvolle Erkenntnisse zu generieren. Diese können dazu beitragen, nicht nur das polizeiliche Handeln in dieser wichtigen Epoche der deutschen Geschichte besser zu verstehen, sondern auch die gesellschaftlichen Prozesse, die es den Nationalsozialisten ermöglichten, dieser zentralen Institution zunächst ihre Funktion als zentraler Träger des staatlichen Gewaltmonopols streitig zu machen, sie anschließend unter ihre Kontrolle zu bringen und schließlich zu einem willigen Instrument ihrer verbrecherischen und menschenverachtenden Politik umzugestalten. Forschungsstand Auch wenn man Alf Lüdtkes Einschätzung aus dem Jahr 1992, dass die Polizeigeschichte ein „Schattendasein“17 führe, mittlerweile wohl nicht mehr uneingeschränkt zustimmen kann, so birgt dieses Themenfeld aber weiterhin ein hohes Forschungspotenzial. Dies ist nicht zuletzt darauf zurückzuführen, dass die Polizei im modernen Begriffsverständnis – d. h. abstrakt als zentraler Träger des staatlichen Gewaltmonopols im Innern18 oder konkreter als „uniformed forces for the prevention of crime and the enforcement of law“19 – erst im Laufe des 19. Jahrhunderts entstand und daher nach historischen Maßstäben eine relativ neue Institution ist, deren wissenschaftliche und historische Erforschung sich noch in einem unausgereiften Stadium befindet.20 In diesem Sinne merkte Robert Reiner noch 1. 16 B. Scheer, Die polizeiliche Einziehungspflicht von Gegenständen nach dem PVG, in: ZDPol, 35. Jg. (1938), Nr. 9 (5.8.1938), S. 192. 17 A. Lüdtke, Einleitung: »Sicherheit« und »Wohlfahrt« – Aspekte der Polizeigeschichte, in: A. Lüdtke [Hrsg.], »Sicherheit« und »Wohlfahrt« – Polizei, Gesellschaft und Herrschaft im 19. und 20. Jahrhundert, Frankfurt a. M. 1992, S. 22. 18 Vgl. C. Dams, Polizei, in: C. Gudehus, M. Christ, Gewalt – Ein interdisziplinäres Handbuch, Stuttgart u. a. 2013, S. 50 f.; J. P. Reemtsma, Organisationen mit Gewaltlizenz – ein zivilisatorisches Grundproblem, in: M. Herrnkind, S. Scheerer [Hrsg.], Die Polizei als Organisation mit Gewaltlizenz, Münster u. a. 2003, S. 9ff. 19 K. Mladek, Police Forces: A Cultural History of an Institution, in: K. Mladek [Hrsg.], Police Forces – A Cultural History of the Police, New York u. a. 2007, S. 3. 20 A. Funk, Polizei und Rechtsstaat – Die Entwicklung des staatlichen Gewaltmonopols in Preußen 1848-1914, Frankfurt a. M. u. a. 1986, S. 13ff.; J. Vogl, State Desire: On the Epoch of the Police, in: K. Mladek [Hrsg.], Police Forces – A Cultural History of the Police, New York u. a. 2007, S. 68; K. Härter, Polizei, in: I. Einleitung 16 im Jahr 2010 an, dass „[t]he academic study of policing is just about 50 years old, […] fairly young by comparison with most disciplines“21, und Clive Emsley und Barbara Weinberger stellten 1991 in Bezug auf die Polizeigeschichte fest, dass „[i]t is only in the last decade or so that the history of police and policing has begun to be taken seriously by academic historians“22. Diese fehlende ‚Reife‘ spiegelt sich insbesondere darin wider, dass es vor allem im angelsächsischen, in eingeschränktem Maß aber auch im deutschsprachigen Raum zwar eine beachtliche Zahl an anspruchsvollen wissenschaftlichen Arbeiten zu polizeigeschichtlichen Themen gibt23, dass sich diese allerdings relativ stark auf einige wenige Epochen und Themen konzentrieren, während zahlreiche andere bisher ungerechtfertigterweise kaum akademische Würdigung erfahren haben. Wenn man den internationalen Forschungsstand und insbesondere die englischsprachige Literatur betrachtet, dann stellt man fest, dass der Schwerpunkt der Polizeigeschichte eindeutig in der Zeit vor dem Ersten Weltkrieg liegt, wobei vor allem die Entstehung der modernen Polizei in der ersten Hälfte des 19. Jahrhunderts intensiv untersucht worden ist24. Die deutschsprachige Poli- F. Jäger [gf. Hrsg.], Enzyklopädie der Neuzeit, Bd. 10 (Physiologie – Religiöses Epos), Stuttgart u. a. 2009, Sp. 170 und Sp. 179; A. Funk, Die Entstehung der modernen Polizei in Preußen 1870-1890; in: H. Reinke [Hrsg.], »… nur für die Sicherheit da …« – Zur Geschichte der Polizei im 19. und 20. Jahrhundert, Frankfurt a. M. u. a. 1993, S. 56ff.; S. Scheerer, M. Herrnkind, Mehr Sicherheit vor Polizeigewalt: das Grundproblem, konkrete Diagnosen und praktische Reformvorschläge, in: M. Herrnkind, S. Scheerer [Hrsg.], Die Polizei als Organisation mit Gewaltlizenz, Münster u. a. 2003, S. V.; T. Newburn, Introduction: understanding policing, in: T. Newburn [Hrsg.], Handbook of Policing, 2. Aufl., Cullompton u. a. 2008, S. 1; R. I. Mawby, Models of policing, in: T. Newburn [Hrsg.], Handbook of Policing, 2. Aufl., Cullompton u. a. 2008, S. 19; C. Emsley, The birth and development of the police, in: T. Newburn [Hrsg.], Handbook of Policing, 2. Aufl., Cullompton u. a. 2008, S. 72; W. Knöbl, Polizei und Herrschaft im Modernisierungsprozess – Staatsbildung und innere Sicherheit in Preußen, England und Amerika 1700-1914, Frankfurt a. M. u. a. 1998, S. 28 f. 21 R. Reiner, The Politics of the Police, 4. Aufl., Oxford u. a. 2010, S. 3. 22 C. Emsley, B. Weinberger, Introduction, in: C. Emsley, B. Weinberger [Hrsg.], Policing Western Europe – Politics, Professionalism and Public Order, 1850-1940, New York u. a. 1991, S. vii. 23 Vgl. R. Jessen, Polizei im Industrierevier – Modernisierung und Herrschaftspraxis im westfälischen Ruhrgebiet 1848-1914, Göttingen 1991, S. 14. 24 Vgl. z. B. Emsley, B. Weinberger, Introduction, S. vii; K. Weinhauer, Schutzpolizei in der Bundesrepublik – Zwischen Bürgerkrieg und Innerer Sicherheit: Die turbulenten sechziger Jahre, Paderborn u. a. 2003, S. 12 m. w. N. 1. Forschungsstand 17 zeigeschichte ist hingegen – wenig überraschend – stärker auf das 20. Jahrhundert und vor allem auf die Zeit des Nationalsozialismus fokussiert.25 Gerade der Forschungsstand zur Polizei in der Weimarer Republik ist aber trotz der offensichtlichen Relevanz dieses Themenfeldes unbefriedigend.26 Obwohl die Weimarer Republik insgesamt und vor allem die Ursachen für ihr Scheitern ganz gewiss nicht zu den in der deutschen Geschichtsschreibung vernachlässigten Themenfeldern gehören, so ist doch die Rolle der Polizei in diesem Zusammenhang bisher auf eher geringes Interesse gestoßen.27 Die meisten Studien zur politischen Gewalt in dieser Zeit beschäftigen sich zwar intensiv mit den politischen Akteuren, d. h. insbesondere mit den linken und rechten Radikalen, die Polizei wird dabei aber in der Regel nur „en passant“28 und „in einem pauschalierenden Tenor“29 behandelt. Hinzu kommt, dass mit Ausnahme der umfassenden und sehr gelungen Dissertation von Peter Leßmann-Faust30 die wenigen historischen Arbeiten, die sich mit der Polizei der Weimarer Republik beschäftigen, in der Regel recht spezielle Fragestellungen oder punktuelle Ereignisse – beispielsweise die Reorganisation der preußischen Polizei in den Anfangsjahren der Republik31, die besonderen Herausforderungen der Berliner Polizei in dieser Zeit32 oder die Niederschlagung des Mitteldeutschen 25 Vgl. Schmidt, Schützen und Dienen, S. 15ff.; A. Lüdtke, M. Sturm, Polizei, Gewalt und Staat im 20. Jahrhundert – Perspektiven, in: A. Lüdtke, H. Reinke, M. Sturm [Hrsg.], Polizei, Gewalt und Staat im 20. Jahrhundert, Wiesbaden 2011, S. 14 f.; Nitschke, Polizei im NS-System, S. 51. 26 Eine umfassende, wenn auch nicht mehr ganz aktuelle Literaturübersicht findet man bei K. Weinhauer, Polizei und innenpolitische Spannungen in der Weimarer Republik, in: Internationale wissenschaftliche Korrespondenz zur Geschichte der deutschen Arbeiterbewegung, 35. Jg. (1999), Nr. 4, S. 554ff. 27 Vgl. Leßmann-Faust, Die Preußische Schutzpolizei, S. 10; H. Reinke, Polizeigeschichte in Deutschland – Ein Überblick, in: P. Nitschke [Hrsg.], Die deutsche Polizei und ihre Geschichte – Beiträge zu einem distanzierten Verhältnis, Hilden 1996, S. 17. 28 Schmidt, Schützen und Dienen, S. 20. 29 Leßmann-Faust, Die Preußische Schutzpolizei, S. 11. 30 Vgl. Leßmann-Faust, Die Preußische Schutzpolizei. 31 Vgl. J. Buder, Die Reorganisation der preußischen Polizei 1918-1923, Frankfurt a. M. u. a. 1986. 32 Vgl. H.-H. Liang, Die Berliner Polizei in der Weimarer Republik, Berlin u. a. 1977 (Original: The Berlin police forces in the Weimar republic, Berkeley u. a. 1970). I. Einleitung 18 Aufstandes im Jahr 1921 durch die preußische Schutzpolizei33 – behandeln, so dass daraus nur eingeschränkt allgemeine Rückschlüsse auf die institutionellen und gesellschaftlichen Herausforderungen der Weimarer Polizei gezogen werden können.34 Wesentlich umfangreicher ist demgegenüber der Literaturbestand zur deutschen Polizeigeschichte in der Zeit der nationalsozialistischen Diktatur.35 Allerdings stellt man auch hier eine gewisse Unausgewogenheit in Bezug auf die bearbeiteten Themen fest, die wiederum auf einen noch bestehen Forschungsbedarf hindeuten.36 So konzentrierte sich lange Zeit das Interesse der Geschichtswissenschaft vor allem auf die Geheime Staatspolizei (Gestapo) als das wohl wichtigste ‚Instrument des Terrors‘ des nationalsozialistischen Regimes.37 Dementsprechend existieren mittlerweile zu diesem Themenfeld zahlreiche Studien, die nicht nur die Methoden und den verbrecherischen Charakter dieser Organisation analysiert, sondern auch ihre Einbettung in die deutsche Gesellschaft und ihre Abhängigkeit von Denunziationen aus der Bevölkerung aufgedeckt haben.38 Später verlagerte sich das Forschungsinteresse stärker auf die Schutzpolizei und ihre umfassende Beteiligung am Vernichtungskrieg in Osteuropa und am Holocaust während des Zweiten Weltkriegs, was neben den sehr einflussreichen und auch in den Medien intensiv diskutierten Arbeiten von Christopher R. Browning39 und Daniel J. Goldhagen40 auch eine Vielzahl an neueren, weniger beachteten, aber gleichwohl erkenntnisreichen Studien hervor- 33 Vgl. C. Knatz, „Ein Heer im grünen Rock“? Der Mitteldeutsche Aufstand 1921, die preußische Schutzpolizei und die Frage der inneren Sicherheit in der Weimarer Republik, Berlin 2000. 34 Vgl. Evans, Rereading German History, S. 75. 35 Eine umfassende, wenn auch nicht mehr ganz aktuelle Literaturübersicht findet man bei H. Reinke, Die deutsche Polizei und das „Dritte Reich“ – Anmerkungen zur Geschichte und Geschichtsschreibung, in: H. Buhlan, W. Jung [Hrsg.], „Wessen Freund und wessen Helfer?“ Die Kölner Polizei im Nationalsozialismus, Köln 2000, S. 51ff. 36 Vgl. Schmidt, Schützen und Dienen, S. 15ff.; Reinke, Polizeigeschichte, S. 19ff. 37 Vgl. J. Lang, Die Gestapo: Instrument des Terrors, Hamburg 1990. 38 Vgl. G. Paul, K.-M. Mallmann, Auf dem Wege zu einer Sozialgeschichte des Terrors – Eine Zwischenbilanz, in: G. Paul, K.-M. Mallmann [Hrsg.], Die Gestapo – Mythos und Realität, Darmstadt 1995, S. 3ff.; N. Frei, Zwischen Terror und Integration – Zur Funktion der politischen Polizei im Nationalsozialismus, in: C. Dipper, R. Hudemann, J. Petersen [Hrsg.], Faschismus und Faschismen im Vergleich, Köln 1998, S. 217ff. 39 Vgl. C. R. Browning, Ganz normale Männer – Das Reserve-Polizeibataillon 101 und die „Endlösung“ in Polen, Reinbek bei Hamburg 1993. 40 Vgl. Goldhagen, Hitlers willige Vollstrecker, S. 219ff. 1. Forschungsstand 19 brachte.41 Dennoch lassen sich auch in Bezug auf die Polizei im Dritten Reich erhebliche Forschungslücken identifizieren, die insbesondere die gesellschaftliche Rolle der ‚regulären‘ Schutz- und Kriminalpolizei in den Jahren vor dem Ausbruch des Zweiten Weltkriegs betreffen.42 Der aus dieser Unausgewogenheit resultierende Forschungsbedarf wird noch dadurch erhöht, dass die historische Analyse der Polizei – insbesondere in Deutschland – lange Zeit sehr einseitig institutionen- und dogmengeschichtlich geprägt war.43 Dementsprechend tragen die meisten Arbeiten auf diesem Gebiet stark organisationsgeschichtliche, verwaltungsjuristische, positivistisch-normative Züge, während theoretische oder methodologische Überlegungen eine sehr untergeordnete Rolle spielen.44 Hinzu kommt ein weitgehend historistisches Grundverständnis von Geschichtsschreibung, das Geschichte als fortlaufende, insbesondere von Individuen vorangetriebene Entwicklung versteht und dabei hauptsächlich einen interpretatorisch-verstehenden Zugang wählt.45 Schließlich ist als weiteres Merkmal der polizeigeschichtlichen Forschung in Deutschland anzuführen, dass sie lange Zeit kaum von im Hochschulbereich beschäftigten Wissenschaftlern mit akademisch geprägten Lebensläufen betrieben wurde, sondern hauptsächlich von historisch interessierten Polizeibeamten, die ihre geschichtswissenschaftlichen Qualifikationen – wenn überhaupt – in ihrer Freizeit erworben hatten, so dass sich die deutsche Polizeigeschichte erst in den 1980er Jahren im universitären Umfeld konstituieren konnte.46 41 Vgl. insb. E. B. Westermann, Hitler's Police Battalions: Enforcing Racial War in the East, Lawrence 2005; S. Klemp, ‚Nicht ermittelt‘ – Polizeibataillone und die Nachkriegsjustiz, 2. Aufl., Essen 2011. 42 Vgl. Schmidt, Schützen und Dienen, S. 17 f. 43 Vgl. Lüdtke, Einleitung: Sicherheit und Wohlfahrt, S. 23 f.; Reinke, Polizeigeschichte, S. 13ff.; Jessen, Polizei im Industrierevier, S. 14ff.; H. Reinke, „Das Amt der Polizei“ – Eine Einleitung, in: H. Reinke [Hrsg.], »… nur für die Sicherheit da …« – Zur Geschichte der Polizei im 19. und 20. Jahrhundert, Frankfurt a. M. u. a. 1993, S. 19 f.; R. J. Evans, Polizei, Politik und Gesellschaft in Deutschland 1700-1933, in: Geschichte und Gesellschaft, 22. Jg. (1996), S. 627. 44 Vgl. B. Löffler, Moderne Institutionengeschichte in kulturhistorischer Erweiterung – Thesen und Beispiele aus der Geschichte der Bundesrepublik Deutschland, in: Historische Zeitschrift, Beiheft 44/2007, Geschichte der Politik: alte und neue Wege (herausgegeben von H.-C. Kraus und T. Nicklas), S. 155ff. 45 Vgl. L. Kolmer, Geschichtstheorien, Paderborn 2008, S. 44ff.; S. Jordan, Theorien und Methoden der Geschichtswissenschaft, 2. Aufl., Paderborn u. a. 2013, S. 41ff.; J. Baberowski, Der Sinn der Geschichte – Geschichtstheorien von Hegel bis Foucault, München 2005, S. 77 f. 46 Vgl. Weinhauer, Schutzpolizei in der Bundesrepublik, S. 12. I. Einleitung 20 Typische Beispiele für diese traditionelle deutsche Polizeigeschichte sind die sehr stark auf polizeiliche Einsatztaktiken und Einsatzziele ausgerichtete Dissertation des Schutzpolizeidirektors Siegfried Zaika über die Bekämpfung von Aufständen durch die preußische Schutzpolizei in der Weimarer Republik47, die auf die Person des Berliner Polizeipräsidenten Carl Ludwig Friedrich von Hinckeldey fokussierte, verwaltungsrechtlich geprägte Dissertation von Stephan M. Eibich zum Zusammenhang von wohlfahrts- und sicherheitspolizeilichen Funktionen Mitte des 19. Jahrhunderts48 oder die ebenfalls in diesem Jahrhundert angesiedelte, begriffsund dogmengeschichtlich orientierte Arbeit von Naoko Matsumoto zur Entwicklung des Polizeibegriffs in der Rheinbundzeit49. Dabei ist die Charakterisierung dieser Arbeiten als ‚traditionell‘ keinesfalls pejorativ gemeint. Diese und zahlreiche weitere, ähnlich gelagerte Studien haben zweifelsohne wesentlich zu einem besseren Verständnis der deutschen Polizei und ihrer Rolle in der Gesellschaft beigetragen und dementsprechend wichtige geschichtliche Erkenntnisse hervorgebracht, auf denen die vorliegende Dissertation aufbaut. Dies gilt insbesondere für die organisationsgeschichtlich geprägte Arbeit von Johannes Buder, die die Reorganisation der preußischen Polizei in den Jahren zwischen 1918 und 1923 sehr detailliert beschreibt und umfassend analysiert und somit eine unverzichtbare Literaturquelle für diese sehr turbulenten Anfangsjahren der Weimarer Republik bildet.50 In noch stärkerem Maße gilt dies aber für die Dissertation von Peter Leßmann-Faust51, die zweifelsohne das zentrale Standardwerk in Bezug auf die preußische Schutzpolizei in der Weimarer Republik darstellt.52 Gleichwohl folgen diese sehr gelungenen und erkenntnisreichen Arbeiten grundsätzlich dem historistischen Ansatz, der den Analyseschwerpunkt auf die Interpretation von bestimmten, als besonders wichtig erachteten 47 Vgl. S. Zaika, Polizeigeschichte: Die Exekutive im Lichte der historischen Konfliktforschung – Untersuchungen über die Theorie und Praxis der preußischen Schutzpolizei in der Weimarer Republik zur Verhinderung und Bekämpfung innerer Unruhen, Lübeck 1979. 48 Vgl. S. M. Eibich, Polizei, »Gemeinwohl« und Reaktion – Über Wohlfahrtspolizei als Sicherheitspolizei unter Carl Ludwig von Hinckeldey, Berliner Polizeipräsident von 1848 bis 1856, Berlin 2004. 49 Vgl. N. Matsumoto, Polizeibegriff im Umbruch – Staatszwecklehre und Gewaltenteilungspraxis in der Reichs- und Rheinbundpublizistik, Frankfurt a. M. 1999. 50 Vgl. Buder, Die Reorganisation der preußischen Polizei. 51 Vgl. Leßmann-Faust, Die Preußische Schutzpolizei. 52 Vgl. z. B. Schmidt, Schützen und Dienen, S. 19; Weinhauer, Schutzpolizei in der Bundesrepublik, S. 12. 1. Forschungsstand 21 geschichtlichen Ereignissen und Personen legt, während einige andere, wichtige Aspekte vernachlässigt werden. Hierzu zählen die Implikationen der gesamtgesellschaftlichen Rahmenbedingungen auf die Polizeiarbeit sowohl auf der institutionellen wie auf der individuellen Ebene, die informellen Prozesse und Routinen im täglichen Umgang der Polizeibeamten mit ihren Kollegen und Vorgesetzten sowie mit dem Bürger, die Wahrnehmung von politischen und organisatorischen Vorgaben durch Polizisten, die Wirkungen polizeilichen Handelns auf den Bürger sowie die für die Polizei typischen, handlungsleitenden Mentalitäten, Einstellungen und Handlungsmuster. Ein besonders gravierendes Defizit scheint in Bezug auf kulturgeschichtliche Analysen der Polizei zu bestehen, denen nach Ansicht von Daniel Schmidt „bislang zu wenig Beachtung geschenkt wurde“, die „bislang unterbelichtet blieben“ und daher im Jahr 2008 „immer noch ein Desiderat“ waren.53 Dies ist umso bedauerlicher, als die Bereitschaft der deutschen Polizei der Zwischenkriegszeit, dem Bürger als ‚Freund und Helfer‘ zur Seite zu stehen oder sich engagiert und effizient am nationalsozialistischen Terror zu beteiligen, zweifelsohne in hohem Maße von den individuellen Handlungs- und Deutungsmustern der handelnden Akteure – d. h. der Polizeibeamten – unter Berücksichtigung ihrer Interessen, Motivationen und Stimmungen in ihrem alltäglichen Handeln und damit von langfristigen kulturellen Prägungen abhing.54 In diesem Zusammenhang erscheint vor allem die Berücksichtigung von organisationskulturellen Aspekten zweckmäßig. Dabei versteht man unter einer Organisationskultur eine Gesamtheit an kollektiven Annahmen und Einstellungen, die das Verhalten von Menschen in Organisationen prägt und die aus organisationalen Werten, Visionen, Normen, Systemen, Prakti- 53 Schmidt, Schützen und Dienen, S. 18. 54 Vgl. T. Kühne, Der nationalsozialistische Vernichtungskrieg im kulturellen Kontinuum des Zwanzigsten Jahrhunderts: Forschungsprobleme und Forschungstendenzen der Gesellschaftsgeschichte des Zweiten Weltkriegs – Zweiter Teil, in: Archiv für Sozialgeschichte, 40. Jg. (2000), S. 440ff.; A. Lüdtke, Funktionseliten: Täter, Mit-Täter, Opfer? Zu den Bedingungen des deutschen Faschismus, in: A. Lüdtke [Hrsg.], Herrschaft als soziale Praxis: historische und sozial-anthropologische Studien, Göttingen 1991, S. 559ff.; A. Lüdtke, Die Praxis von Herrschaft: Zur Analyse von Hinnehmen und Mitmachen im deutschen Faschismus, in: W. Röhr, B. Berlekamp [Hrsg.], Terror, Herrschaft und Alltag im Nationalsozialismus – Probleme einer Sozialgeschichte des deutschen Faschismus, Münster 1995, S. 226ff. I. Einleitung 22 ken und Symbolen besteht.55 Gerade vor dem Hintergrund, dass die Polizeikultur als eine der stärksten Organisationskulturen überhaupt gilt56, ist davon auszugehen, dass dieses bisher in polizeihistorischen Arbeiten kaum berücksichtigte organisationssoziologische Konstrukt57 einen wichtigen Beitrag dazu leisten könnte, um die Polizei und ihr Handeln in der deutschen Gesellschaft der Zwischenkriegszeit besser verstehen zu können. Zusammenfassend lässt sich folglich festhalten, dass es auf dem Gebiet der deutschen Polizeigeschichte eine Vielzahl an noch nicht hinreichend untersuchten Fragestellungen gibt, die sich für historische Analysen anbieten. An eben diesen Defiziten in der bisherigen polizeihistorischen Forschung setzt die vorliegende Dissertation an, die darauf abzielt, neue historische Erkenntnisse zu generieren, indem sie eine umfassende, kulturgeschichtlich orientierte Analyse der Rolle der Polizei in der deutschen Zwischenkriegszeit liefert. Was diese Entscheidung zugunsten eines kulturgeschichtlichen Ansatzes bedeutet, soll im folgenden Abschnitt erläutert werden, der sich mit den geschichtstheoretischen Grundlagen dieser Arbeit beschäftigt. Forschungsansatz und Quellen Auch wenn in der Fachliteratur durchaus vereinzelt die Meinung vertreten wird, dass die Geschichte keine Theorie brauche, da sie bei genauerer Betrachtung gar keine Wissenschaft, sondern vielmehr eine Kunst sei58, so hat sich doch mittlerweile zweifellos die Position einer ‚Theoriebedürftigkeit‘ 2. 55 Vgl. z. B. E. H. Schein, Organizational Culture and Leadership, 3. Aufl., San Francisco 2004, S. 3ff.; A. Vera, Organisation und Personalmanagement in der Polizei, Frankfurt a. M. 2015, S. 55ff.; A. Vera, L. Jablonowski, Organisationskultur der Polizei, in: J. Stierle, D. Wehe, H. Siller [Hrsg.], Handbuch Polizeimanagement, Polizeipolitik – Polizeiwissenschaft – Polizeipraxis, Bd. 1, Wiesbaden 2017, S. 476ff. 56 Vgl. E. A. Thibault, L. M. Lynch, R. B. McBride, Proactive Police Management, 5. Aufl., Upper Saddle River 2001, S. 17. 57 Eine solche ansatzweise Berücksichtigung findet man bei Schmidt, Schützen und Dienen, S. 210ff. und S. 385; Westermann, Hitler's Police Battalions, S. 7ff. und S. 231 f.; M. Becker, Organisationskultur der Sicherheitspolizei im Nationalsozialismus, in: in: A. Lüdtke, H. Reinke, M. Sturm [Hrsg.], Polizei, Gewalt und Staat im 20. Jahrhundert, Wiesbaden 2011, S. 249ff. 58 Vgl. z. B. G. Mann, Plädoyer für die historische Erzählung, in: J. Kocka, T. Nipperdey [Hrsg.], Theorie der Geschichte, Bd. 3: Theorie und Erzählung in der Geschichte, München 1979, S. 40ff. 2. Forschungsansatz und Quellen 23 der Geschichte, die die Wissenschaftlichkeit der Geschichte und ihren fachlichen Status als akademische Disziplin betont59, durchgesetzt. Gerade weil Geschichte immer subjektiv, von der Perspektive des Historikers geprägt ist, ist es umso wichtiger, sich mit den theoretischen Voraussetzungen der Geschichtsschreibung, d. h. mit den Regeln der Auslegung und Sinngebung des jeweiligen Historikers, zu beschäftigen.60 Die Generierung von neuen Erkenntnissen über die Vergangenheit mit dem Anspruch, dass diese auch wahr sind, setzt dementsprechend voraus, dass der Historiker über sein wissenschaftliches Tun, seine Erkenntnisziele und seine Methodik reflektiert und diese kritisch hinterfragt.61 In diesem Sinne umschreibt Jörn Rüsen die theoretischen Grundlagen der Geschichtswissenschaft als „‚Zurückbeugung‘ des historischen Denkens auf sich selbst“62, und Jörg Baberowski stellt in Bezug auf das in diesem Kontext entstehende, unvermeidliche Spannungsfeld zwischen Subjektivität und Wahrheitsanspruch fest: „‚Wahr‘ ist eine Geschichte dann, wenn sie die Prämissen erfüllt, die der Historiker aufgestellt hat. […] Es kommt stets nur darauf an, anderen mitzuteilen, wie man zu einer Interpretation gekommen ist.“63 Insofern erscheint es im Rahmen einer geschichtswissenschaftlichen Dissertation geboten, sich auf der Meta-Ebene mit der der Arbeit zu Grunde liegenden geschichtstheoretischen Grundposition auseinanderzusetzen. Wie bereits oben angemerkt worden ist, liegt diese in der vorliegenden Dissertation in der Kulturgeschichte, wobei allerdings sozialhistorische Aspekte ebenfalls eine wichtige Rolle spielen. Obwohl in der geschichtstheoretischen Literatur üblicherweise zwischen Sozial- und Kulturgeschichte differenziert wird und es zweifelsohne auch deutliche Unterschiede zwischen diesen beiden Ansätzen gibt, so sind sie aber keinesfalls inkompatibel miteinander. Wie die folgenden Ausführungen zeigen, weisen sie nicht nur einige wichtige Gemeinsamkeiten auf, sondern sie lassen sich sehr gut 59 Vgl. R. Koselleck, Über die Theoriebedürftigkeit der Geschichtswissenschaft, in: W. Conze [Hrsg.], Theorie der Geschichtswissenschaft und Praxis des Geschichtsunterrichts, Stuttgart 1972, S. 10ff.; J. Rüsen, Historik – Theorie der Geschichtswissenschaft, Köln u. a. 2011, S. 20 f. 60 Vgl. Kolmer, Geschichtstheorien, S. 9ff.; Jordan, Theorien und Methoden, S. 19ff. 61 Vgl. R. R. Tietjen, Einleitung, in: S. Foerster, J. ten Haar, S. M. Schumacher, M. Seddiqzai, T. Tenhaef, R. R. Tietjen [Hrsg.], Blumen für Clio: Einführung in Methoden und Theorien der Geschichtswissenschaft aus studentischer Perspektive, Marburg 2011, S. 15ff.; Rüsen, Historik, S. 53ff. 62 Rüsen, Historik, S. 23. 63 Baberowski, Der Sinn der Geschichte, S. 9. I. Einleitung 24 bei der Analyse eines Themas ergänzend miteinander verbinden, so dass eine umfassende kulturhistorische Auseinandersetzung mit der deutschen Polizei in der Zwischenkriegszeit ohne die Berücksichtigung von sozialhistorischen Argumenten und Konzepten kaum möglich ist. Sowohl die Sozial- als auch die Kulturgeschichte sind relativ junge Ansätze, die sich erst nach 1945 zu dominanten geschichtswissenschaftlichen Strängen entwickelten, wobei die Sozialgeschichte der ältere Ansatz ist. Der historische Ursprung beider Ansätze wird üblicherweise – trotz der unübersehbaren sozialhistorischen Prägung des von Karl Marx und Friedrich Engels im Jahr 1848 veröffentlichten ‚Kommunistischen Manifests‘64 und der wichtigen Vorarbeiten von Max Weber65 – in der ersten Hälfte des 20. Jahrhunderts und insbesondere in der Gründung der französischen, historischen Fachzeitschrift ‚Annales d’histoire économique et sociale‘ im Jahr 1929 durch Marc Bloch und Lucien Febvre gesehen, die wiederum namensgebend für die so genannte ‚Annales-Schule‘ war.66 Die Vertreter dieses als Gegenbewegung zum damals dominierenden Historismus entstandenen Ansatzes „plädieren für eine analytische Geschichtswissenschaft, […] die mehr [ist] als nur politische Geschichte und die Geschichte der ‚Großen‘. Sie verlagern den Schwerpunkt der Analyse von individuellen und elitären Ereignissen zu kollektiven Prozessen der großen sozialen Gruppen und Klassen, die sich ständig wiederholen, sozial weit verbreitet sind und im Allgemeinen den Basisstrukturen der Geschichte entsprechen“67. Dabei wurde von Anfang an eine interdisziplinare Öffnung der Geschichtswissenschaft vorangetrieben, die im Wesentlichen in der Übernahme von Theorien und Methoden der Sozialwissenschaften und hier insbesondere 64 Vgl. K. Marx, F. Engels, Manifest der Kommunistischen Partei, London 1848, http://mlwerke.de/me/me04/me04_459.htm (Zugriff: 12.2.2018). 65 Vgl. S. M. Schumacher, Die Historische Sozialwissenschaft, in: S. Foerster, J. ten Haar, S. M. Schumacher, M. Seddiqzai, T. Tenhaef, R. R. Tietjen [Hrsg.], Blumen für Clio: Einführung in Methoden und Theorien der Geschichtswissenschaft aus studentischer Perspektive, Marburg 2011, S. 569; Baberowski, Der Sinn der Geschichte, S. 1126ff.; Jordan, Theorien und Methoden, S. 76ff.;. 66 Vgl. J. Revel, Die Annales, in: in: J. Eibach, G. Lottes [Hrsg.], Kompass der Geschichtswissenschaft, Göttingen 2002, S. 23ff.; Jordan, Theorien und Methoden, S. 80ff. und S. 100; Baberowski, Der Sinn der Geschichte, S. 140ff. 67 S. Förster, Die französische Schule der „Annales“, in: S. Foerster, J. ten Haar, S. M. Schumacher, M. Seddiqzai, T. Tenhaef, R. R. Tietjen [Hrsg.], Blumen für Clio: Einführung in Methoden und Theorien der Geschichtswissenschaft aus studentischer Perspektive, Marburg 2011, S. 557. 2. Forschungsansatz und Quellen 25 der Soziologie und Ökonomie, aber auch der Psychologie, Geographie und Linguistik, bestand. Wichtige theoretische Beiträge der Annales-Schule waren neben Fernand Braudels Konzept der ‚longue durée‘68, das die für die Sozialgeschichte charakteristische Vorstellung einer sehr langfristigen, langsamen Entwicklung von gesellschaftlichen, politischen und wirtschaftlichen Strukturen, aber auch von geographischen Gegebenheiten, in den Mittelpunkt der historischen Erkenntnisgewinnung rückte, auch die zunehmende Fokussierung auf den Mentalitätsbegriff, der wiederum in der sich später entwickelnden Kulturgeschichte eine zentrale Rolle spielen sollte.69 Auch wenn die Annales-Schule nach dem Zweiten Weltkrieg sowohl in Frankreich als auch international rasch an Bedeutung gewann und diese Zeit als „das goldene Zeitalter der Sozialgeschichte“70 gilt, so blieb in der deutschen Geschichtswissenschaft der Historismus noch einige Jahrzehnte dominant. Zwar stellte Friedrich Meinecke bereits wenige Monate nach dem Kriegsende fest, dass das traditionelle deutsche Geschichtsbild „einer gründlichen Revision“71 bedurfte, womit er zweifelsohne auch den vorherrschenden Historismus meinte, allerdings dauerte es dann bis weit in die 1960er Jahre hinein, bis die Vertreter des historistischen Geschichtskonzepts an (west-) deutschen Universitäten durch jüngere Historiker ersetzt wurden, die zunächst vor allem eine sozialhistorische Orientierung aufwiesen.72 Dabei war die Sozialgeschichte jedoch von Anfang an kein monolithischer Theorieansatz, sondern eher ein Sammelbegriff für mehrere geschichtswissenschaftliche Ansätze wie die Strukturgeschichte73, die Sozialgeschichte74, die Historische Sozialwissenschaft75 und die von diesen Ansätzen geprägte Wirtschafts- und Technikgeschichte, deren Bezeichnungen 68 Vgl. F. Braudel, Histoire et sciences sociales: la longue durée, in: Annales – Histoire – Sciences Sociales, 13. Jg. (1958), Nr. 4. S. 725ff. 69 Vgl. Revel, Die Annales, S. 32 f.; Jordan, Theorien und Methoden, S. 84. 70 J. Eibach, Sozialgeschichte, in: in: J. Eibach, G. Lottes [Hrsg.], Kompass der Geschichtswissenschaft, Göttingen 2002, S. 13. 71 F. Meinecke, Die deutsche Katastrophe – Betrachtungen und Erinnerungen, Wiesbaden 1946, S. 157. 72 Vgl. Jordan, Theorien und Methoden, S. 97ff.; Eibach, Sozialgeschichte, S. 9ff. 73 Vgl. W. Conze, Die Strukturgeschichte des technisch-industriellen Zeitalters als Aufgabe für Forschung und Unterricht, Köln u. a. 1957, S. 5ff. 74 Vgl. J. Kocka, Sozialgeschichte: Begriff, Entwicklung, Probleme, Göttingen 1977, S. 48ff. 75 Vgl. Schumacher, Die Historische Sozialwissenschaft, S. 565ff.; P. Nolte, Historische Sozialwissenschaft, in: J. Eibach, G. Lottes [Hrsg.], Kompass der Geschichtswissenschaft, Göttingen 2002, S. 53ff. I. Einleitung 26 in der Literatur oftmals uneinheitlich und umstritten sind76 und die sich trotz eines gemeinsamen „sozialhistorischen Denkstils“77 dennoch deutlich voneinander unterscheiden.78 Dies zeigt sich auch in den Schwierigkeiten, eine geeignete Definition zu formulieren, die zu einer Vielzahl von unbefriedigenden Begriffsabgrenzungen geführt hat, wie z. B. George M. Trevelyans eher anekdotisch gemeinte Definition von Sozialgeschichte als „history of a people with the politics left out“79 oder der die deutschsprachige Literatur dominierende, auf Jürgen Kocka zurückgehende, präzise und umfassende, dafür aber ziemlich unhandliche ‚doppelte Begriff‘ der Sozialgeschichte, der diese „zum einen als Geschichte eines Teilbereichs („Sektorwissenschaft“), zum anderen als sozialgeschichtlicher Zugriff zur Analyse der allgemeinen Geschichte („Gesellschaftsgeschichte“) bestimmt“80. Gerade dieses letztgenannte Konzept von Sozialgeschichte als allgemeiner Geschichte, das historische Entwicklung als Wechselspiel von Politik, Gesellschaft, Kultur und Wirtschaft betrachtet, dabei auf Interdisziplinarität, Theorie- und Methodenvielfalt sowie Internationalität des wissenschaftlichen Diskurses setzt, insbesondere von soziologischen Ansätzen beeinflusst wird, sich intensiv mit sozioökonomischen Phänomenen beschäftigt und dessen Vertreter tendenziell eher im linken politische Spektrum verortet werden,81 ist für die vorliegende Dissertation von Bedeutung. Die zentrale geschichtstheoretische Grundlage dieser Arbeit bildet allerdings die Kulturgeschichte, die seit den 1970er Jahren im Zuge der zunehmenden Kritik an der Sozialgeschichte massiv an Bedeutung gewonnen und sich seit den 1990er Jahren als so genannte ‚Neue Kulturgeschichte‘ zu einem der führenden Ansätze sowohl in der geschichtsinteressierten Öf- 76 Vgl. z. B. Schumacher, Die Historische Sozialwissenschaft, S. 566 f.; Jordan, Theorien und Methoden, S. 103 f. 77 Eibach, Sozialgeschichte, S. 10. 78 Vgl. J. Kocka, Sozialgeschichte: Begriff, Entwicklung, Probleme, 2. Aufl., Göttingen 1986, S. 48ff.; Jordan, Theorien und Methoden, S. 102; K. Nathaus, Sozialgeschichte und Historische Sozialwissenschaft, in: Docupedia-Zeitgeschichte, 24.9.2012, S. 1 f., http://docupedia.de/zg/ (Zugriff: 12.2.2018); G. Schulz, Sozialgeschichte, in: G. Schulz, C. Buchheim, G. Fouquet, R. Gömmel, F.-W. Henning, K. H. Kaufhold, H. Pohl [Hrsg.], Sozial- und Wirtschaftsgeschichte: Arbeitsgebiete – Probleme – Perspektiven, Stuttgart 2005, S. 283 f. 79 G. M. Trevelyan, Illustrated English Social History, I: Chaucer’s England and the Early Tudors, London u. a. 1951, S. XI. 80 Kocka, Sozialgeschichte, S. 4 f. 81 Vgl. Eibach, Sozialgeschichte, S. 13 f.; Jordan, Theorien und Methoden, S. 102 f.; Nathaus, Sozialgeschichte und Historische Sozialwissenschaft, S. 2. 2. Forschungsansatz und Quellen 27 fentlichkeit als auch innerhalb der akademischen Geschichtswissenschaft entwickelt hat.82 Diese von Hans-Ulrich Wehler als „Attacke […] gegen die theoriegeleitete Sozial- und Gesellschaftsgeschichte“83 bezeichnete Kritik richtete sich insbesondere gegen die Tendenz von Sozialhistorikern, soziale Phänomene zu ‚verdinglichen‘, den Wahrnehmungsweisen und Handlungsspielräumen der historischen Subjekte zu wenig Beachtung zu schenken, die sprachlichen Bedingungen und Vermittlungsformen von Geschichte zu vernachlässigen und zu unkritisch gegenüber modernisierungstheoretischen Ansätzen zu sein.84 Die als Gegenbewegung zu einer so verstandenen Sozialgeschichte entstandene Kulturgeschichte ist allerdings so vielschichtig und heterogen85, dass eine präzise und dennoch aussagekräftige Begriffsabgrenzung wohl noch schwieriger als bei der Sozialgeschichte ist, was beispielsweise Ute Daniel als wichtige Vertreterin dieses Ansatzes in wissenschaftstheoretisch höchst fragwürdiger Weise dazu bewegt, den Lesern ihres ‚Kompendiums Kulturgeschichte‘ bewusst eine klare Definition von Kulturgeschichte vorzuenthalten, um sie dann aufzufordern, zu „studieren, wie über sie gestritten und wie mit ihr gearbeitet wird, und seine oder ihre eigenen Schlüsse daraus zu ziehen“86. Der in der Literatur mittlerweile verbreitetste Ansatz zur Definition von Kulturgeschichte basiert auf einer bestimmten Perspektivierung.87 Da die moderne Kulturwissenschaft Kultur nicht im Sinne eines feuilletonistischen Kulturbegriffs als „dasjenige […], das übrig bleibt, nachdem man Politik, Gesellschaft, Wirtschaft, Recht, Technik und alle weiteren ‚harten‘ 82 Vgl. A. Landwehr, Kulturgeschichte, Stuttgart 2009, S. 6; A. Landwehr, Kulturgeschichte, in: Docupedia-Zeitgeschichte, 14.5.2013, S. 1ff., http://docupedia.de/z g/ (Zugriff: 12.2.2018); Nathaus, Sozialgeschichte und Historische Sozialwissenschaft, S. 10; U. Daniel, Kompendium Kulturgeschichte: Theorien, Praxis, Schlüsselwörter, Frankfurt a. M. 2001, S. 7. 83 H.-U. Wehler, Die Herausforderung der Kulturgeschichte, München 1998, S. 7. 84 Vgl. M. Dinges, Neue Kulturgeschichte, in: in: J. Eibach, G. Lottes [Hrsg.], Kompass der Geschichtswissenschaft, Göttingen 2002, S. 179; Jordan, Theorien und Methoden, S. 154ff.; Wehler, Die Herausforderung der Kulturgeschichte, München 1998, S. 7ff.; E. Yamasaki, Foucaults Archäologie – historische Diskursanalyse nach Foucault und ihre Bedeutung für die Geschichtswissenschaft, in: S. Foerster, J. ten Haar, S. M. Schumacher, M. Seddiqzai, T. Tenhaef, R. R. Tietjen [Hrsg.], Blumen für Clio: Einführung in Methoden und Theorien der Geschichtswissenschaft aus studentischer Perspektive, Marburg 2011, S. 593 f.; Nathaus, Sozialgeschichte und Historische Sozialwissenschaft, S. 9. 85 Vgl. Dinges, Neue Kulturgeschichte, S. 192; Kolmer, Geschichtstheorien, S. 77 f.. 86 Vgl. Daniel, Kompendium Kulturgeschichte, S. 7ff. (Zitat: S. 9). 87 Vgl. Landwehr, Kulturgeschichte, in: Docupedia-Zeitgeschichte, S. 5ff. I. Einleitung 28 Fakten des Lebens subtrahiert hat“88, versteht, sondern als „Sinnproduktion“89 bzw. als „Bedeutungs-System, welches die Akteure mit Zeichen, Symbolen, Begriffen und Deutungsmustern ausstattet, die ihr soziales Handeln motivieren, orientieren und reglementieren“90, scheint Kultur „alles und überall zu sein“91. Dementsprechend kann es keinen spezifischen Gegenstandsbereich der Kulturgeschichte geben, und es können grundsätzlich alle Objekte Gegenstand von kulturgeschichtlichen Analysen werden.92 Das zentrale Konstitutionsmerkmal der Kulturgeschichte ist daher nicht ihr Gegenstand, sondern die Perspektivierung auf Sinnmuster und Bedeutungskontexte und dementsprechend ihr primäres Interesse an „den Formen, mit denen Gesellschaften der Vergangenheit ihre Wirklichkeiten überhaupt erst zu sinnvollen Wirklichkeiten gestaltet haben, […] den Transformationen, denen diese Weltdeutungen unterworfen waren, […] den Bedingungen und Möglichkeiten, unter denen sie entworfen werden konnten, sowie […] den vielfachen Auswirkungen (beispielsweise auch und gerade politischer Art), die sie hatten“93. Im Mittelpunkt kulturhistorischer Analysen stehen folglich sinnbildende Akteure mit bestimmten Handlungsspielräumen, die ihre historischen Lebenswelten auf bestimmte Art und Weise wahrnehmen, sich aneignen und deuten.94 Auf diese Weise verbindet Kulturgeschichte die historische Mikro- und Makroperspektive, d. h. sowohl die gesamtgesellschaftlichen Strukturen und Prozesse einer Epoche als auch kurzzeitige, kleinräumliche Phänomene und den Lebensalltag der Menschen – und zwar nicht nur der ‚großen Männer der Geschichte‘, sondern vor allem der ‚kleinen Leute‘.95 Eine so verstandene Kulturgeschichte ist daher keinesfalls als ‚Bindestrich- 88 Landwehr, Kulturgeschichte, in: Docupedia-Zeitgeschichte, S. 5. 89 Landwehr, Kulturgeschichte, Stuttgart 2009, S. 11. 90 R. Sieder, Kulturwissenschaften: Fragen und Theorien – Erste Annäherung, in: C. Lutter, M. Szöllösi-Janze, H. Uhl [Hrsg.], Kulturgeschichte: Fragestellungen, Konzepte, Annäherungen, Innsbruck u. a. 2004, S. 26 (Hervorhebung im Original). 91 Landwehr, Kulturgeschichte, Stuttgart 2009, S. 9. 92 Vgl. Dinges, Neue Kulturgeschichte, S. 180; Landwehr, Kulturgeschichte, Stuttgart 2009, S. 11; Daniel, Kompendium Kulturgeschichte, S. 8 f. 93 Landwehr, Kulturgeschichte, in: Docupedia-Zeitgeschichte, S. 6. 94 Vgl. C. Lutter, M. Szöllösi-Janze, H. Uhl, Einleitung, in: C. Lutter, M. Szöllösi-Janze, H. Uhl [Hrsg.], Kulturgeschichte: Fragestellungen, Konzepte, Annäherungen, Innsbruck u. a. 2004, S. 8 f. 95 Vgl. Landwehr, Kulturgeschichte, in: Docupedia-Zeitgeschichte, S. 4 f.; Jordan, Theorien und Methoden, S. 157ff.; Dinges, Neue Kulturgeschichte, S. 179 f. 2. Forschungsansatz und Quellen 29 Geschichte‘ wie die Wirtschafts- oder die Medizingeschichte zu sehen, sondern – wie die Sozialgeschichte96 – als allgemeine Geschichte bzw. als eigenständige geschichtswissenschaftliche Konzeption, deren spezifischen Fragestellungen und Methoden grundsätzlich auf alle geschichtlichen Phänomene und Epochen angewendet werden können.97 In der vorliegenden Dissertation soll nun der so verstandene kulturhistorische Ansatz auf die Polizei im Deutschland der Zwischenkriegszeit angewendet werden. Untersucht werden sollen die Rolle, die Funktion und die Bedeutung der deutschen Polizei zwischen den Jahren 1918 und 1939 im Spannungsfeld von Politik, Gesellschaft, Kultur und Wirtschaft. Um ein umfassendes und ausgewogenes Verständnis dieser Institution und ihrer damaligen politischen, gesellschaftlichen und institutionellen Herausforderungen zu erhalten, erscheint es unerlässlich, die theoretischen Erkenntnisse der Herrschafts- und Polizeisoziologie mit den gesamtgesellschaftlichen und insbesondere auch politischen Entwicklungen in der Weimarer Republik und im nationalsozialistischen Deutschland in Verbindung zu bringen und dabei die individuellen, subjektiven Handlungs- und Deutungsmuster der Polizeibeamten in ihrem mehr oder weniger alltäglichen polizeilichen Handeln und der Interaktion mit dem polizeilichen Gegen- über, z. B. beim Streifendienst, im Umgang mit streikenden Arbeitern oder bei der Eindämmung und Bekämpfung von gewalttätigen Demonstrationen oder großflächigen Unruhen, zu berücksichtigen. Dass eine solcher kulturhistorischer Analyseansatz nicht nur möglich, sondern aufgrund der engen Verflechtung der kulturellen Dimension mit anderen Dimensionen historischer Wirklichkeit und insbesondere mit den sozialen und politischen Strukturen, Prozessen und Handlungen98 sogar geboten ist, spiegelt sich auch in der zunehmenden Integration von kulturgeschichtlichen Konzepten in die Sozialgeschichte wider, so dass Stefan Jordan sogar von der ‚Neuen Kulturgeschichte als neuer Sozialgeschichte‘ spricht.99 Für die Zweckmäßigkeit dieses geschichtstheoretischen Ansatzes in Bezug auf die Polizei spricht nicht zuletzt die Tatsache, dass es in der Polizeigeschichte mittlerweile sehr gelungene Beispiele hierfür gibt.100 Die 96 Vgl. Jordan, Theorien und Methoden, S. 108 f. 97 Vgl. Daniel, Kompendium Kulturgeschichte, S. 11ff.; Landwehr, Kulturgeschichte, Stuttgart 2009, S. 12 f. 98 Vgl. Schulz, Sozialgeschichte, S. 297 f.; Kocka, Sozialgeschichte, S. 156; Nolte, Historische Sozialwissenschaft, S. 65. 99 Vgl. Jordan, Theorien und Methoden, S. 178ff. 100 Vgl. Weinhauer, Schutzpolizei in der Bundesrepublik, S. 12ff.; Schmidt, Schützen und Dienen, S. 18 f. I. Einleitung 30 vorliegende Dissertation soll sich in diese bestehenden Arbeiten einreihen und auf diese Weise dazu beitragen, eine „kulturhistorisch erweiterte Organisations- und Sozialgeschichte der Polizei“101 zu entwickeln. Die vorliegende Arbeit wertet dabei aber nicht nur die vorhandene geschichtswissenschaftliche Literatur zu diesem Themenfeld aus. Um neue, historisch relevante Erkenntnisse über die deutsche Polizei in der Zwischenkriegszeit zu generieren, wird vielmehr auf eine historische Quelle zurückgegriffen, die bisher nur sporadisch und nicht systematisch in der Literatur zu diesem Thema berücksichtigt worden ist, nämlich die in der deutschen Zwischenkriegszeit, d. h. zwischen November 1918 und September 1939, in der Zeitschrift ‚Die Polizei‘ (ZDPol) erschienenen Beiträge. Die ZDPol ist eine im Jahr 1904 gegründete, polizeinahe Fachzeitschrift102, die dem Internetauftritt des Verlages zufolge „seit über hundert Jahren Polizeiführungskräften in Vollzugsdienst, Verwaltung und Wissenschaft Orientierung und Entscheidungshilfen an[bietet], die für ihre tägliche Aufgabenerfüllung unerlässlich sind [… und …] mit aktuellen Lageberichten, praxisbezogener Kommentierung gesetzlicher Vorschriften, flankiert von einem breiten Spektrum polizeiwissenschaftlicher Abhandlungen, zuverlässig über den Diskussionstand auf allen polizeiführungsrelevanten Fachgebieten [informiert].“103 Herausgeber der Zeitschrift sind leitende Beamte der Innenministerien und der Polizeien des Bundes und der Länder, und auch ihr Autoren- und Leserkreis umfasst fast ausschließlich Polizeipraktiker sowie in den Ausund Fortbildungsinstitutionen der Polizei beschäftigte Personen. Diese nehmen in der Regel hohe und teilweise sogar sehr hohe hierarchische Positionen in der Polizei ein, was sich insbesondere an den angegebenen Dienstgraden der Autoren festmachen lässt. Folglich spiegeln die publizierten Beiträge im Wesentlichen die Binnenperspektive der Polizei auf die behandelten Themen und die von der Leitungsebene der Polizei vertretenen Ansichten wider. Auch wenn die ZDPol sicherlich eine geringere Auflage 101 Weinhauer, Schutzpolizei in der Bundesrepublik, S. 12. 102 Vgl. H. Aden, Polizeinahe Fachzeitschriften – Formen und Grenzen des Einflusses auf polizeiliche Deutungsmuster und politische Entscheidungsprozesse, in: H.-J. Lange [Hrsg.], Die Polizei der Gesellschaft – Zur Soziologie der Inneren Sicherheit, Opladen 2003, S. 357ff. 103 http://shop.wolterskluwer.de/wkd/shop/shop,1/die-polizei,0032-3519,carl-heyma nns-verlag,7537/ (Zugriff: 8.1.2018). 2. Forschungsansatz und Quellen 31 hat als die von den im Polizeiwesen tätigen Gewerkschaften herausgegebenen, kostenlos an ihre Mitglieder versandten Zeitschriften, insbesondere die von der Gewerkschaft der Polizei (GdP) herausgegebene ‚Deutsche Polizei‘ oder der vom Bund Deutscher Kriminalbeamter (BDK) herausgegebene ‚Der Kriminalist‘, so muss man sie heutzutage aber dennoch aufgrund ihres relativ breiten Leserkreises und ihres eher wissenschaftlichen, auf ein Fachpublikum abzielenden Formats zu den wichtigsten und einflussreichsten Zeitschriften im Polizeisegment zählen.104 Welche Bedeutung der ZDPol in der deutschen Zwischenkriegszeit zukam, ist aus heutiger Sicht schwer einzuschätzen. Grundsätzlich deutet der ab April 1921 geltende Untertitel ‚Zeitschrift für das gesamte Polizei- und Kriminalwesen mit Einschluß der Landjägerei‘ auf eine breite Leserschaft hin, die deutlich über das Zielpublikum der anderen, in der damaligen Zeit erscheinenden polizeinahen Zeitschriften wie z. B. ‚Der Gendarm‘ oder die ‚Preußische Polizeibeamtenzeitung‘ hinausging. Für eine herausragende Rolle dieser Zeitschrift in diesen Anfangsjahren der Weimarer Republik spricht auch der auf dem Deckblatt jedes Heftes abgedruckte Hinweis, dass mit dem Bezug dieser Zeitschrift ohne weitere Beitragsleistung eine Mitgliedschaft in der Polizei-Unfallfürsorgekasse verbunden war, sowie die Tatsache, dass sie ab April 1921 von der ‚Freien Vereinigung für Polizei- und Kriminalwissenschaft‘ als Publikationsorgan gewählt wurde. Der damalige Vorsitzende dieser Vereinigung, Bill Drews, ehemaliger preußischer Innenmister und ab 1921 Präsident des Preußischen Oberverwaltungsgerichts, stellte hierzu am 5. April 1921 auf der ersten Seite des ersten Heftes des Jahrgangs 1921/22 fest: „Eine der Hauptaufgaben ist es nunmehr, den neugeschaffenen großen Polizeibeamtenkörper mit dem Geist des Berufs, Hüter der staatlichen Ordnung, Schützer des Lebens und der Güter der Volksgenossen zu sein, zu durchdringen und ihm die vielseitigen Kenntnisse zu vermitteln, die ein wirklich brauchbarer Polizeibeamter besitzen muss. Mittel zu diesem Zweck soll die Herausgabe einer Fachzeitschrift sein, die auf das beste geleitet, sich die wissenschaftliche Weiterbildung aller Polizeibeamten zum Ziele setzt und damit die Bestrebungen auf Heranbildung eines vorzüglichen, modernen Polizeikörpers unterstützt. […] Als Organ hat die ‚Freie Vereinigung für Polizei- und Kriminalwissenschaft‘ die Zeitschrift ‚Die Polizei‘ gewählt, die den neuen Aufgaben 104 Vgl. Aden, Polizeinahe Fachzeitschriften, S. 358ff. I. Einleitung 32 entsprechend umgestaltet wird. Die Bestrebungen der Vereinigung werden vom Ministerium des Innern unterstützt.“105 Bestätigt wurde die im letzten Satz angemerkte Unterstützung durch das preußische Innenministerium im auf der nächsten Seite folgenden Geleitwort des Ministerialdirigenten und späteren Staatssekretärs im preußischen Innenministerium Wilhelm Abegg, der in Bezug auf die Funktion der ZDPol anmerkte: „Nachdem einige Verbände gemeinsam ein wertvolles wissenschaftliches Organ ins Leben gerufen haben, hat sich der Verlag dieser Zeitschrift das hohe Ziel gesteckt, mit ihr der gesamten Beamtenschaft im Sinne bester Aus- und Fortbildung zu dienen. […] Möchte es der mit dem heutigen Tage in neuen Gewande erscheinenden Zeitschrift ‚Die Polizei‘ gelingen, entsprechend den Leitsätzen des von ihr veröffentlichten Aufrufes ihr Ziel zu Nutz und Frommen der gesamten Polizeibeamtenschaft zu erreichen!“106 Bereits die Tatsache, dass gerade diese Zeitschrift als Publikationsorgan der ‚Freien Vereinigung für Polizei- und Kriminalwissenschaft‘ ausgewählt wurde, lässt darauf schließen, dass sie vermutlich auch schon vor 1921 über eine breite Leserschaft in der Polizei verfügt haben dürfte. Diese hohe Reichweite müsste dann ab 1921 aufgrund der von höchster politischer Stelle geförderten Weiterentwicklung der Zeitschrift zu einem führenden Medium der polizeilichen Aus- und Fortbildung, das sich an die gesamte Polizei unabhängig von Funktion, Hierarchie und Region richtete, noch zugenommen haben. Wie ein am 5. Dezember 1922 in dieser Zeitschrift veröffentlichter Erlass des preußischen Innenministeriums belegte, dürfte sich ihre Stellung als führende polizeinahe Fachzeitschrift im Laufe des Jahres 1922 aufgrund der ministeriell verfügten, kostenfreien Lieferung der Zeitschrift an alle Polizeibehörden weiter gefestigt haben. „Durch meinen Runderl. v. 7.3.1922 […] habe ich mich damit einverstanden erklärt, daß sämtliche Kommandos und sämtliche Hundertschaften je ein Stück der Fachzeitschrift ‚Die Polizei‘ […] beziehen. Mit Rücksicht darauf, daß ‚Die Polizei‘ den Schutzpolizeibeamten sehr viel Wissenswertes bietet und durch gediegene fachwissenschaftliche 105 B. Drews, Aufruf zur Bildung einer Freien Vereinigung für Polizei- und Kriminalwissenschaft, in: ZDPol, 18. Jg. (1921/22), Nr. 1 (5.4.1921), S. 1. 106 W. Abegg, Geleitwort zur neuen Ausgabe der Zeitschrift ‚Die Polizei‘, in: ZD- Pol, 18. Jg. (1921/22), Nr. 1 (5.4.1921), S. 2. 2. Forschungsansatz und Quellen 33 Aufsätze sowie durch Mitteilung maßgebender Gerichtsentscheidungen und ministerieller Erlasse ganz besonders zur Hebung der beruflichen und allgemeinen Bildung der Schutzpolizeibeamten auf der gebotenen neutralen Grundlage geeignet ist, genehmige ich […] auch die Bestellung der genannten Zeitschrift für sämtliche Wachstuben der Schutzpolizei […].“107 Die Etablierung der ZDPol als eine der führenden polizeinahen Zeitschriften in der Weimarer Republik betonte schließlich einige Jahre später der promovierte Polizeimajor a. D. Ernst Koch, der seinen am 10. April 1928 zum 25jährigen Bestehen der Zeitschrift erschienenen Beitrag mit dem folgenden Satz begann: „In unserer schnellebigen Zeit ist es schon etwas Besonderes um eine Zeitschrift, die sich fünfundzwanzig Jahre hindurch nicht nur gehalten, sondern zu einer außerordentlich stark verbreiteten Druckschrift entwickelt hat, die in maßgebenden Fachkreisen vielfach als das führende Blatt angesprochen wird.“108 Insofern kann – auch ohne genaue Kenntnis der genauen Abonnentenbzw. Leserzahlen – davon ausgegangen werden, dass die in der Zwischenkriegszeit in der ZDPol erschienenen Beiträge durchaus auf eine hohe Resonanz in der Polizei gestoßen sein dürften und dass den darin geäußerten Einschätzungen und Ansichten eine nicht unerhebliche Repräsentativität bezüglich der in der Polizei vorherrschenden Wahrnehmungs- und Deutungsmuster zugekommen sein dürfte. Gleichwohl ist zu berücksichtigen, dass die Beiträge in der ZDPol nicht zwangsläufig realitätsgetreue, objektive Beschreibungen der Polizeiarbeit enthielten. Zum einen konnten die jeweiligen Autoren unterschiedliche individuelle Ziele, z. B. Karriere, Honorar oder Idealismus, mit ihren Publikationen verfolgen. Zum anderen ist davon auszugehen, dass die ZDPol – wie andere polizeinahe Fachzeitschriften damals und auch heute noch – mindestens die drei folgenden Funktionen erfüllte: (1) Artikulation der Interessen der Polizei als Berufsgruppe, (2) Verbreitung von Wahrnehmungsund Deutungsmustern der Polizeipraxis in Form von Fachwissen und spezifischen Interpretationen von gesellschaftlichen Entwicklungen und (3) 107 o. V., Lieferung d. Zeitschrift ‚Die Polizei‘ für die Wachstuben, in: ZDPol, 19. Jg. (1922/23), Nr. 17 (5.12.1922), S. 296. 108 E. Koch, ‚Die Polizei‘ – 25 Jahre im Dienste der Polizei, in: ZDPol, 25. Jg. (1928/29), Nr. 7 (10.4.1928), S. 171-178. I. Einleitung 34 Einflussnahme auf politische Entscheidungsprozesse.109 Die darin publizierten Beiträge „unterliegen einem historischen Wandel“ und „spiegeln die jeweiligen Diskussionsthemen der Polizeipraxis, die Professionalisierung der Polizeiarbeit […] und auch Veränderungen der Kriminal- und Gesellschaftspolitik insgesamt wider.“110 Dementsprechend zielt die Analyse der in der ZDPol erschienen Beiträge in dieser Dissertation weniger auf die objektive Erfassung und Beschreibung der Entwicklung der Polizei, des tatsächlichen polizeilichen Handelns oder der öffentlichen Wahrnehmung der Polizei ab, da dies vermutlich umfassender und treffender in der vorhandenen, auf einer breiten Quellenbasis beruhenden, geschichtswissenschaftlichen Literatur abgebildet wird, die ja ebenfalls in der vorliegenden Arbeit ausgewertet wird. Vielmehr sollen durch die Analyse der Beiträge in der ZDPol neue Erkenntnisse über die Selbstwahrnehmung und Selbstdarstellung der Polizei111 und ihre Wahrnehmung und Einschätzung der politischen und gesellschaftlichen Entwicklungen in der deutschen Gesellschaft der Zwischenkriegszeit gewonnen werden. Gerade die Gegenüberstellung dieser neuen Ergebnisse mit den bisherigen, in der vorhandenen Literatur enthaltenen Erkenntnissen verspricht wertvolle Rückschlüsse auf die Rolle, die Funktion und Bedeutung der Polizei im Deutschland der Zwischenkriegszeit. Über diese ‚klassische‘ Funktion der ZDPol als empirisches Quellenmaterial hinaus können die darin erschienenen Beiträge aber auch in ihrer Gesamtheit als Diskurs betrachtet werden. Folgt man Dietrich Busses und Wolfgang Teuberts pragmatischer Definition von Diskursen als „virtuelle Textkorpora“, der zufolge „[z]u einem Diskurs […] alle Texte [gehören], – die sich mit einem als Forschungsgegenstand gewählten Gegenstand, Thema, Wissenskomplex oder Konzept befassen, untereinander semantische Beziehungen aufweisen und/oder in einem gemeinsamen Aussage-, Kommunikations-, Funktions- oder Zweckzusammenhang stehen, 109 Vgl. Aden, Polizeinahe Fachzeitschriften, S. 363ff. 110 Aden, Polizeinahe Fachzeitschriften, S. 366. 111 Vgl. H. M. Pannbacker, Die Polizei im Bild der ‚Polizei‘ – Die Preußische Schutzpolizei zwischen Weimarer Republik und Drittem Reich in Selbstdarstellungen, in: Archiv für Polizeigeschichte, 7. Jg. (1996), Nr. 1, S. 21ff.; Schmidt, Schützen und Dienen, S. 26. 2. Forschungsansatz und Quellen 35 – den als Forschungsprogramm vorgegebenen Eingrenzungen in Hinblick auf Zeitraum/Zeitabschnitte, Areal, Gesellschaftsausschnitt, Kommunikationsbereich, Texttypik und andere Parameter genügen, – und durch explizite oder implizite (text- oder kontextsemantisch erschließbare) Verweisungen aufeinander Bezug nehmen bzw. einen intertextuellen Zusammenhang bilden“112, dann scheint dies durchaus zulässig zu sein. Dies gilt umso mehr, wenn man berücksichtigt, dass das Gestaltungsinteresse des Wissenschaftlers und auch praktische Kriterien, wie z. B. die Verfügbarkeit entsprechender Texte, ausschlaggebend bei der Abgrenzung eines Diskurses sind, so dass „das Korpus selbst […] das Untersuchungsobjekt und damit auch die erzielbaren Ergebnisse [konstituiert]“113. In diesem Sinne sollen die in der ZDPol zwischen November 1918 und September 1939 erschienen Beiträge in der vorliegenden Dissertation auch als fachwissenschaftlich-berufsständischer Diskurs der deutschen Polizei in der Zwischenkriegszeit analysiert werden. Angesichts des kulturgeschichtlichen Zugangs der vorliegenden Dissertation legt dies den Einsatz einer diskursanalytischen Methodik nahe, für die sich in der Geschichtswissenschaft die Bezeichnungen ‚Diskursgeschichte‘ und ‚Historische Diskursanalyse‘ etabliert haben.114 Dieser Ansatz umfasst eine ganze Reihe von theoretischen Ansätzen, deren Entwicklung auf den erkenntnistheoretischen Perspektivwechsel des ‚linguistic turn‘ zurückgeführt wird und deren zentrales Merkmal dementsprechend „die konstitutive Rolle der Sprache […] nicht nur für die Er- 112 D. Busse, W. Teubert, Ist Diskurs ein sprachwissenschaftliches Objekt? in: D. Busse, F. Hermanns, W. Teubert [Hrsg.], Begriffsgeschichte und Diskursgeschichte – Methodenfragen und Forschungsergebnisse der historischen Semantik, Opladen 1994, S. 14. 113 Busse, Teubert, Ist Diskurs ein sprachwissenschaftliches Objekt? S. 15. Vgl. auch Daniel, Kompendium Kulturgeschichte, S. 354 f. 114 Vgl. z. B. Daniel, Kompendium Kulturgeschichte, S. 353ff.; D. Busse, Begriffsgeschichte oder Diskursgeschichte? Zu theoretischen Grundlagen und Methodenfragen einer historisch-semantischen Epistemologie, in: C. Dutt [Hrsg.], Herausforderungen der Begriffsgeschichte, Heidelberg 2003, S. 17ff.; A. Landwehr, Historische Diskursanalyse, Frankfurt a. M. u. a. 2008, S. 13ff.; P. Sarasin, Geschichtswissenschaft und Diskursanalyse, Frankfurt a. M. 2003, S. 10ff. I. Einleitung 36 kenntnis der Wirklichkeit, sondern auch für die Wirklichkeit selbst“115 ist. Die Analyse von Diskursen geht dabei über die Untersuchung der Bedeutung und der Intentionalität von Sprache bzw. Sprechakten hinaus und betrachtet insbesondere die Machtstrukturen, die durch Sprache und Sprechen bestimmt werden.116 Davon ausgehend, dass Diskurse keine Beschreibung der Wirklichkeit liefern, sondern diese Wirklichkeit selbst produzieren, versucht die historische Diskursanalyse „die Wissens-, Wirklichkeitsund Rationalitätsstrukturen vergangener Gesellschaften zu analysieren“, indem sie fragt, „welche Aussagen zu welchem Zeitpunkt an welchem Ort auftauchen [… und …] warum ausgerechnet diese Aussagen und keine anderen aufgetreten sind“117. Der in der geschichtswissenschaftlichen Literatur wohl am häufigsten zitierte diskursanalytische Ansatz ist die historische Diskursanalyse nach Michel Foucault (1926–1984), die am ausführlichsten in seiner im Jahr 1969 erstmals veröffentlichten ‚Archäologie des Wissens‘ erläutert wird.118 Im Mittelpunkt dieses Ansatzes steht die Analyse von Diskursen als begrenzten Kommunikationsräumen, die bereits vor ihrer sprachlichen Formulierung existiert haben, sowie als „Praktiken […], die systematisch die Gegenstände bilden, von denen sie sprechen“119. Gleichwohl orientieren sich die meisten historischen Arbeiten, die sich auf Michel Foucaults Diskursanalyse berufen, lediglich grob an seinem Diskursbegriff, ohne seine komplexe, hermeneutische Verfahren komplett ablehnende, teilweise unpräzise, widersprüchliche, kaum nachvollziehbare und daher wenig ergiebige Methodik tatsächlich anzuwenden, so dass man wohl oftmals in der Tat von einem „deklamatorische[n] Lippenbekenntnis“120 ausgehen sollte.121 Angesichts der Schwierigkeiten, mit denen sich die Geschichtswissenschaft im Fall einer streng dogmatischen Umsetzung von Michel Foucaults Überlegungen konfrontiert sieht, ist es nicht verwunderlich, dass 115 Sarasin, Geschichtswissenschaft und Diskursanalyse, S. 11 f. Vgl. auch z. B. Jordan, Theorien und Methoden, S. 188 f.; Yamasaki, Foucaults Archäologie, S. 593 f. 116 Vgl. Jordan, Theorien und Methoden, S. 190. 117 Landwehr, Kulturgeschichte, Stuttgart 2009, S. 40 f. 118 Vgl. M. Foucault, Archäologie des Wissens, Frankfurt a. M. 1981 (Erstveröffentlichung: 1969). 119 Foucault, Archäologie des Wissens, S. 74. 120 Wehler, Die Herausforderung der Kulturgeschichte, S. 8. 121 Vgl. Yamasaki, Foucaults Archäologie, S. 613; Wehler, Die Herausforderung der Kulturgeschichte, S. 77ff.; W. Kruse, Die Erfindung des modernen Militarismus – Krieg, Militär und bürgerliche Gesellschaft im politischen Diskurs der Französischen Revolution 1789-1799, München 2003, S. 12. 2. Forschungsansatz und Quellen 37 dieser Ansatz in der Forschungspraxis eher als Werkzeugkiste, aus der sich Historiker bedienen können122, oder einfach nur als Anregung für kulturhistorische Arbeiten fungiert.123 Ein sehr pragmatischer, sicherlich etwas polemisch gemeinter, aber gleichwohl zweckmäßiger Vorschlag, wie man Michel Foucaults Ansatz für historische Studien nutzbar machen kann, stammt von Hans-Ulrich Wehler als einem seiner prominentesten und zugleich härtesten deutschsprachigen Kritiker124: „Man kann historisch spezifizierte Diskurse bearbeiten unter Berücksichtigung ihrer kausalen Genese, ihrer sozialen Träger, ihrer ‚Torhüter- Mechanismen‘, die über Exklusion oder Inklusion entscheiden, ihrer diskussionsexternen Kontrolleure der Regelbeachtung, ihres Adressatenkreises, ihrer faktisch erreichten Öffentlichkeit, ihrer nachweisbaren Wirkungsgeschichte, ihres Untergangs und der Gründe dafür. Dabei muß man sich jede ‚Archäologie‘ und ‚Genealogie‘ aus dem Kopf schlagen, aber eine historisch saubere Diskursanalyse ist durchaus vorstellbar, und danach kommt alles auf die Interpretation an, welchen Einfluß, welches belegbare Gewicht, kurz: welche Wirkung dieser Diskurs im historischen Prozeß gehabt hat.“125 In diesem Sinne versteht sich die vorliegende Dissertation weniger als Beitrag zum ‚linguistic turn‘ oder zur Historischen Diskursanalyse im engeren Sinne, sondern vielmehr als diskursgeschichtlich inspirierte, kulturgeschichtliche Analyse der deutschen Polizei in der Zwischenkriegszeit. Die in der ZDPol publizierten Beiträge sollen daher „nicht nur als empirisches Quellenmaterial [begriffen werden], sondern zugleich auch als ein so inte- 122 Vgl. Landwehr, Historische Diskursanalyse, S. 78. 123 Vgl. Yamasaki, Foucaults Archäologie, S. 613 f.; Daniel, Kompendium Kulturgeschichte, S. 357ff. 124 Eine äußerst pointierte Zusammenfassung seiner Kritik findet man bei Wehler, Die Herausforderung der Kulturgeschichte, S. 91, wo er festhält: „Wegen der erkenntnistheoretisch abstrusen Prämissen seiner ‚Archäologie‘ und ‚Genealogie‘, wegen der zahlreichen Mängel seiner Vorstellung von Diskursanalyse, wegen seines undifferenzierten Machtbegriffs, wegen der Verweigerung diskussionsfähiger normativer Auskünfte, wegen der systematischen und historischen Defizite seiner Diagnose der ‚Disziplinargesellschaft‘, wegen der endlosen Mängelserie seiner sogenannten empirischen Studien ist Foucault ein intellektuell unredlicher, empirisch absolut unzuverlässiger, kryptonormativistischer ‚Rattenfänger‘ für die Postmoderne.“. 125 Wehler, Die Herausforderung der Kulturgeschichte, S. 91. I. Einleitung 38 graler wie wirkungsmächtiger, verarbeitender und zugleich gestaltender Bestandteil des gesellschaftlichen Geschehens selbst“126. Um die Zwischenkriegszeit – d. h. den Zeitraum zwischen dem 9. November 1918 und dem 1. September 1939 – komplett zu erfassen, sind die 22 Jahrgänge zwischen 1918/19 und 1939 der ZDPol berücksichtigt worden. Sie erschien im Betrachtungszeitraum in der Regel vierzehntägig mit einem Seitenumfang von ca. 500 bis 800 Seiten pro Jahr, so dass die 22 betrachteten Jahrgänge insgesamt mehr als 14.000 Seiten umfassen. Dementsprechend können natürlich nicht alle in diesem Zeitraum publizierten Beiträge im Detail dargestellt und analysiert werden, sondern lediglich diejenigen, die unter Berücksichtigung des Forschungsziels und des Erkenntnisinteresses des Forschenden als besonders aussagekräftig in Bezug auf die Probleme und Herausforderungen der Polizei in der Zwischenkriegszeit eingeschätzt werden.127 Hierzu zählen insbesondere die Fachartikel, Stellungnahmen oder Kommentierungen, die bestimmte polizeiliche Problem- und Handlungsfelder oder politische, gesellschaftliche Ereignisse in diesem Zeitraum aus der Perspektive der dem polizeilichen Umfeld zuzurechnenden Autoren beschreiben, analysieren und bewerten. Die mehr als 170 konkret ausgewerteten und in Auszügen wörtlich zitierten Quellen umfassen ca. 1.000 Seiten und werden als fachwissenschaftlich-berufsständischer Diskurs vor dem Hintergrund der polizeisoziologischen und geschichtswissenschaftlichen Forschung interpretiert. Dabei werden insbesondere die Entwicklung der in der Polizei verbreiteten Wahrnehmungsund Deutungsmuster im Laufe des mehr als 20jährigen Untersuchungszeitraums und damit gezielt auch Kontinuitäten über historische Brüche hinweg und Diskontinuitäten in scheinbar stabilen Phasen in den Blick genommen, um neue Erkenntnisse über die deutsche Polizei in der Zwischenkriegszeit zu gewinnen. Die vorliegende Arbeit gliedert sich wie folgt. Nach dieser Einleitung werden im zweiten Kapitel zunächst die theoretischen Grundlagen dieser Dissertation ausführlich erläutert. Diese in geschichtswissenschaftlichen Studien leider oftmals vernachlässigte theoretische Fundierung ist gerade in einer Arbeit, die dem kulturhistorischen Ansatz folgt, unerlässlich, um die Ergebnisse der Quellen- und Literaturanalyse korrekt und sinnvoll einzuordnen und um tiefgehende, belastbare und aussagekräftige Erkenntnisse über die Rolle, die Funktion und die Bedeutung der Polizei in der deutschen Gesellschaft zu gewinnen. In diesem Sinne wird daher zunächst der 126 Kruse, Die Erfindung des modernen Militarismus, S. 11. 127 Vgl. Busse, Teubert, Ist Diskurs ein sprachwissenschaftliches Objekt? S. 16ff. 2. Forschungsansatz und Quellen 39 Begriff der ‚Polizei‘ abgegrenzt, bevor dann der eigentliche theoretische Kern dieser Studie behandelt wird, der angesichts der thematischen Ausrichtung in der Soziologie liegt. Im dritten Kapitel wird der historische Kontext dieser Arbeit in groben Zügen dargestellt. Dies betrifft zum einen die geschichtliche Entwicklung der Polizei von ihren Anfängen im Alten Ägypten über die europäische Antike, das Mittelalter und die Neuzeit bis zum Beginn der im Mittelpunkt dieser Dissertation stehenden Zwischenkriegszeit, wobei ab dem Mittelalter zunehmend die deutsche Polizei in den Fokus rückt. Zum anderen wird ein geschichtlicher Überblick über die deutsche Zwischenkriegszeit, d. h. die Weimarer Republik und das Dritte Reich bis zum Ausbruch des Zweiten Weltkriegs, gegeben, wobei das Hauptaugenmerk auf denjenigen geschichtlichen Ereignissen und Entwicklungen gelegt wird, die einen starken Bezug zur Sicherheitslage aufweisen und damit unmittelbar das Aufgabenfeld der Polizei betreffen. Im vierten Kapitel, dem wichtigsten und daher auch längsten Teil der vorliegenden Dissertation, erfolgt dann eine Auseinandersetzung mit der Entwicklung und den politischen, gesellschaftlichen und institutionellen Herausforderungen der deutschen Polizei im Betrachtungszeitraum. Im Mittelpunkt steht die Analyse der in der ZDPol zwischen November 1918 und September 1939 publizierten Beiträge und ihre Interpretation vor dem Hintergrund der polizeihistorischen Literatur für diese Epoche. Dabei wird dem chronologischen Ablauf folgend die Entwicklung der Polizei in der Zwischenkriegszeit in vier Phasen unterteilt, nämlich (1) eine Phase des Zusammenbruchs und Neuaufbaus der Polizei in den turbulenten Anfangsjahren der Weimarer Republik zwischen 1918 und 1923, (2) eine Phase der Professionalisierung und Demokratisierung der Polizei in den ‚ruhigen Jahren‘ der Republik zwischen 1924 und 1929, (3) eine Phase der Stagnation und Kapitulation der Polizei in den späten Krisenjahren der Republik zwischen 1930 und 1932 und schließlich (4) eine Phase der Entgrenzung und Ideologisierung der Polizei im Dritten Reich zwischen 1933 und 1939. Abschließend werden im fünften Kapitel die Ergebnisse dieser Arbeit zusammengefasst und ein Fazit gezogen. I. Einleitung 40 Theoretische Grundlagen Der Polizeibegriff Eine präzise und eindeutige Abgrenzung des Begriffs ‚Polizei‘ ist überaus schwierig.128 Dies liegt nicht zuletzt daran, dass sich die Bedeutung des Begriffs Polizei – bzw. in seinen alten Schreibweisen Policey oder Polizey – im Laufe der letzten fünf Jahrhunderte deutlich verändert hat129 und dass bis weit in das 20. Jahrhundert hinein unklar war, „was unter ‚Polizei‘, sei es im weiteren oder engeren Sinne, verstanden werden soll“130. Daher erscheint es im Rahmen einer polizeihistorischen Dissertation zweckmäßig, diese Entwicklung zumindest grob im Sinne einer begriffsgeschichtlichen Analyse zu rekonstruieren.131 Anschließend wird dann das moderne Verständnis des Polizeibegriffs genauer erörtert. Begriffsgeschichte Der erste schriftliche Nachweis des vermutlich vom griechischen ‚politeía‘ in den Werken von Aristoteles abgeleiteten Policeybegriffs132 findet sich II. 1. a) 128 Zu den folgenden Ausführungen vgl. Vera, Organisation und Personalmanagement, S. 10ff.; A. Vera, Die Kolonialpolizei als Instrument kolonialer Herrschaftssicherung in Deutsch-Südwestafrika und Togo, in: A. Vera [Hrsg.], Die Polizei im Fokus von Wissenschaft und Forschung – Polizeiwissenschaftliche Studien aus soziologischer, ökonomischer, philosophischer und historischer Perspektive, Münster 2015, S. 226 f. 129 Vgl. Härter, Polizei, Sp. 171. 130 K. von der Groeben, Die Erfüllung von allgemeinen und polizeilichen Aufgaben, in: K. G. A. Jeserich, H. Pohl, G.-C. von Unruh [Hrsg.], Deutsche Verwaltungsgeschichte – Bd. 3: Das Deutsche Reich bis zum Ende der Monarchie, Stuttgart 1984, S. 439. 131 Zur Begriffsgeschichte vgl. z. B. R. Koselleck, Einleitung, in: O. Brunner, W. Conze, R. Koselleck [Hrsg.], Geschichtliche Grundbegriffe: Historisches Lexikon zur politisch-sozialen Sprache in Deutschland, Bd. 1, Stuttgart 1972, S. XIIIff.; Jordan, Theorien und Methoden, S. 127ff. 132 Vgl. A. Iseli, Gute Policey – Öffentliche Ordnung in der Frühen Neuzeit, Stuttgart 2009, S. 8 f.; W. E.J. Weber, Polizeiwissenschaft, in: F. Jäger [gf. Hrsg.], Enzyklopädie der Neuzeit, Bd. 10 (Physiologie – Religiöses Epos), Stuttgart u. a. 2009, Sp. 183; P. Leßmann-Faust, Geschichte der Polizei, in: M. Kniesel, E. 41 in der Bestätigung einer Wiener Handwerksordnung aus dem Jahr 1451 durch Kaiser Friedrich III.133 Ab dem 16. Jahrhundert wurde der Policeybegriff dann in Mittel- und Westeuropa insbesondere im städtischen Kontext zunehmend verwendet.134 Dabei verstand man unter ‚guter Policey‘ einen „anzustrebenden Zustand guter öffentlicher Ordnung, entsprechende Normen in Form von Edikten oder Gesetzen […] und den entsprechenden obrigkeitlichen Aktivitätsbereich im Staatsinneren“135. Dementsprechend umfasste der Policeybegriff eine Vielzahl an sehr unterschiedlichen Regelungsgegenständen wie z. B. Wasser- und Lebensmittelversorgung, Kleiderordnungen, Armen- und Bettelwesen, Bauwesen oder Feuerlöschwesen, aber auch die Ahndung von Vergehen wie z. B. Ehebruch, Gotteslästerung oder Wucher.136 Im Laufe des 17. Jahrhunderts bewirkten dann die Reformen des ‚aufgeklärten Absolutismus‘, die ökonomisch-kameralistischen Ordnungsvorstellungen des Merkantilismus und die zunehmende Urbanisierung eine Weiterentwicklung des Policeybegriffs in zwei Richtungen. Zum einen kristallisierten sich wohlfahrtspoliceyliche Aufgaben heraus, die insbesondere das Gesundheitswesen, die Armenfürsorge sowie die Bildung und die Wirtschaftsförderung betrafen, und zum anderen sicherheitspoliceyliche Aufgaben, die auf die Aufrechterhaltung der öffentlichen Sicherheit und Ordnung abzielten.137 Diesem vormodernen Begriffsverständnis folgend stellte die Policey aber noch keine Institution oder Organisation im heutigen Sinne dar, sondern eher „ein Bündel an Aufgaben, mit denen verschiedene Institutionen betraut waren“138. Kube, M. Murck, [Hrsg.], Handbuch für Führungskräfte der Polizei – Wissenschaft und Praxis, Lübeck 1996, S. 11; Matsumoto, Polizeibegriff imUmbruch, S. 12; P. Nitschke, Die Polizierung aller Lebensbereiche: Sozialdisziplinierung und ihre polizeilichen Implikationen in der Prämoderne, in: P. Nitschke [Hrsg.], Die deutsche Polizei und ihre Geschichte – Beiträge zu einem distanzierten Verhältnis, Hilden 1996, S. 32 f. 133 Vgl. Härter, Polizei, Sp. 171. 134 Vgl. Iseli, Gute Policey, S. 10ff. 135 Weber, Polizeiwissenschaft, Sp. 183. 136 Vgl. Härter, Polizei, Sp. 171ff.; Iseli, Gute Policey, S. 8ff.; Eibich, Polizei, Gemeinwohl und Reaktion, S. 81ff. Lüdtke, Einleitung: Sicherheit und Wohlfahrt, S. 11ff.; H. Reinke, “Armed as if for a War” – The State, The Military And The Professionalisation Of The Prussian Police in Imperial Germany, in: C. Emsley, B. Weinberger [Hrsg.], Policing Western Europe – Politics, Professionalism and Public Order, 1850-1940, New York u. a. 1991, S. 58 f. 137 Vgl. Härter, Polizei, Sp. 175 f.; Iseli, Gute Policey, S. 32ff.; Eibich, Polizei, Gemeinwohl und Reaktion, S. 334ff. 138 Dams, Polizei, S. 51. II. Theoretische Grundlagen 42 Die Polizei im heutigen, modernen Begriffsverständnis entstand dann ab dem Ende des 18. Jahrhunderts in Mittel- und Westeuropa139, als sich der Polizeibegriff im Zuge der Französischen Revolution, der Napoleonischen Kriege und der Industrialisierung zunehmend auf die Gewährleistung der öffentlichen Sicherheit und Ordnung verengte.140 Dieser Prozess erstreckte sich allerdings über einen Zeitraum von mehr als 100 Jahren, so dass wohlfahrtspolizeiliche Aufgaben bis zum Beginn des 20. Jahrhunderts weiterhin eine zentrale Rolle im Rahmen der alltäglichen Polizeiarbeit in Deutschland und anderen westlichen Staaten spielten.141 Zudem ist die zunehmende Fokussierung auf sicherheitspolizeiliche Funktionen keinesfalls als gradlinige, zielgerichtete, bewusst gesteuerte Entwicklung zu sehen. Herbert Reinke merkte in diesem Zusammenhang treffend an, dass die in der Literatur oftmals aufgestellte These, dass mit Inkrafttreten von § 10 Abs. 2 des Allgemeinen Landrechts für die Preußischen Staaten (PrALR) am 5. Februar 1794 „der entscheidende erste Schritt von der ‚Polizey‘ des Absolutismus, die sich als umfassende Verwaltung verstand, hin zu einer modernen Polizeikonzeption getan worden [sei], in deren Rahmen die Polizei seither primär mit der Aufrechterhaltung der öffentlichen Sicherheit, d. h. mit der Kriminalitätskontrolle, der Gefahrenabwehr und der Mithilfe bei der Strafverfolgung, befasst gewesen sei [, …] zu den größten Mißverständnissen der preußisch-deutschen Polizeihistoriographie“142 gehört. Vielmehr muss die zunehmende Verdrängung von wohlfahrtspolizeilichen durch sicherheitspolizeiliche Aufgaben im Laufe des 19. und zu Beginn des 20. Jahrhunderts als Ergebnis von mehreren, nicht unmittelbar miteinander zusammenhängenden Entwicklungen gesehen werden, die insbesondere mit der Art und Weise polizeilicher Machtausübung143, der zunehmenden Verrechtlichung und Stärkung des staatlichen Gewaltmono- 139 Vgl. Leßmann-Faust, Geschichte der Polizei, S. 11ff.; Liang, The Rise of Modern Police, S. 3 und S. 8. 140 Vgl. Reinke, Das Amt der Polizei, S. 19; Mladek, Police Forces, S. 3; Lüdtke, Einleitung: Sicherheit und Wohlfahrt, S. 11 f. 141 Vgl. Reinke, Polizeigeschichte, S. 17; Reinke, Das Amt der Polizei, S. 18ff. und S. 21 f.; Funk, Polizei und Rechtsstaat, S. 24; Liang, The Rise of Modern Police, S. 2; Lüdtke, Einleitung: Sicherheit und Wohlfahrt, S. 12 f. 142 Reinke, Das Amt der Polizei, S. 18 f. 143 Vgl. A. Lüdtke, »Gemeinwohl«, »Polizei« und »Festungspraxis« – Staatliche Gewaltsamkeit und innere Verwaltung in Preußen, 1815-1850, Göttingen 1982, S. 323ff. 1. Der Polizeibegriff 43 pols144 und städtischen Entwicklungsprozessen auf der kommunalen Ebene145 zusammenhingen und die im Ergebnis die Polizei im heutigen, modernen Begriffsverständnis entstehen ließen. Diese ‚Geburtsstunde‘ der modernen Polizei wird in der angelsächsischen Literatur normalerweise auf das Jahr 1829 datiert, als in London die Metropolitan Police als „centrally controlled, uniformed watchmen with a rigid work discipline geared for supervising the streets and, in theory, for preventing rather than detecting crime“146 eingerichtet wurde.147 In der deutschsprachigen Literatur wird in diesem Zusammenhang hingegen in der Regel auf die Einrichtung der Berliner Schutzmannschaft im Juli 1848 verwiesen, die wiederum auf einer grundlegenden Reform des Berliner Polizeiwesens nach dem Vorbild der Metropolitan Police beruhte.148 Diese beiden Polizeien unterschieden sich von ihren historischen Vorgängern aber nicht nur durch die stärkere Fokussierung auf sicherheitspolizeiliche Aufgaben149, sondern auch durch eine inhaltliche Veränderung dieser Sicherheitsfunktion. Zielte diese bis zu Beginn des 19. Jahrhunderts noch vor allem auf die kurzfristige Unterdrückung von Aufständen und Unruhen ab, so setzte sich in der Folgezeit zunehmend ein Polizeimodell durch, das insbesondere auf permanenten, flächendeckenden und damit präventiv 144 Vgl. Funk, Polizei und Rechtsstaat, S. 201ff., S. 312ff. 145 Vgl. Jessen, Polizei im Industrierevier, S. 57ff. 146 C. Emsley, The birth and development of the police, in: T. Newburn [Hrsg.], Handbook of Policing, 2. Aufl., Cullompton u. a. 2008, S. 73. 147 Vgl. Reiner, The Politics of the Police, S. 39ff.; Emsley, The birth and development of the police, S. 72ff.; P. Rawlings, Policing before the police, in: T. Newburn [Hrsg.], Handbook of Policing, 2. Aufl., Cullompton u. a. 2008, S. 47. 148 Vgl. Funk, Die Entstehung der modernen Polizei, S. 56 f.; Leßmann-Faust, Geschichte der Polizei, S. 15; R. Jessen, Preußische Polizei und Arbeiterschaft im Kaiserreich, in: P. Nitschke [Hrsg.], Die deutsche Polizei und ihre Geschichte – Beiträge zu einem distanzierten Verhältnis, Hilden 1996, S. 49; Dams, Polizei, S. 51; Eibich, Polizei, Gemeinwohl und Reaktion, S. 63ff.; F. Hatje, Repräsentationen der Staatsgewalt – Herrschaftsstrukturen und Selbstdarstellung in Hamburg 1700-1900, Basel u. a. 1997, S. 66 f. 149 Vgl. Lüdtke, Einleitung: Sicherheit und Wohlfahrt, S. 14 f.; Jessen, Preußische Polizei und Arbeiterschaft, S. 52; M. Graßmann, Die Polizei in der Bundesrepublik Deutschland – Begriffsbestimmung und Entwicklungslinien 1945 bis 1990, in: J. Grutzpalk, A. Bruhn, J. Fatianova, F. Harnisch, C. Mochan, B. Schülzke, T. Zischke [Hrsg.], Beiträge zu einer vergleichenden Soziologie der Polizei, Potsdam 2009, S. 91. II. Theoretische Grundlagen 44 wirkenden Kontrollaufgaben beruhte.150 Zudem begann sich im Wilhelminischen Deutschland im letzten Viertel des 19. Jahrhunderts ein deutlich liberaleres Polizeiverständnis zu etablieren, das in Einklang mit den zeitgenössischen rechtsstaatlichen Vorstellungen dem Schutz des Bürgers vor unberechtigten staatlichen Eingriffen eine hohe Bedeutung beimaß.151 Auf diese Weise wurde aus der paternalistisch-bevormundenden Policey der Vormoderne152 die „bürokratisch organisierte, rechtsförmig handelnde und mit einer starken Exekutivgewalt versehene“153 Polizei der Moderne.154 Modernes Begriffsverständnis Eine unmissverständliche, präzise und zugleich aussagekräftige Abgrenzung des Polizeibegriffs ist auch heutzutage nicht unproblematisch. Wenig hilfreich sind insbesondere die häufig in den Medien verwendeten Abgrenzungen der Polizei als Gewaltmonopolist bzw. als ‚Organisation mit Gewaltlizenz‘155. Dass die Polizei kein Gewaltmonopol besitzt, erkennt man nicht zuletzt daran, dass unter bestimmten Bedingungen jeder Mensch berechtigt ist, Gewalt anzuwenden, z. B. bei Notwehr gemäß § 32 Abs. 2 Strafgesetzbuch (StGB) oder bei Jedermann-Festnahmen gemäß § 127 Strafprozessordnung (StPO). Das Gewaltmonopol liegt vielmehr beim Staat, der festlegen kann, wem unter welchen Bedingungen der Einsatz von Gewalt erlaubt werden soll, und die Polizei ist lediglich ein – wenn auch sehr wichtiger – Träger dieses staatlichen Gewaltmonopols bzw. der zentrale Träger dieses Monopols im Inland.156 Und der Begriff der ‚Gewaltlizenz‘ erscheint in diesem Kontext angesichts der Tatsache, dass der Einb) 150 Vgl. Leßmann-Faust, Geschichte der Polizei, S. 15; Funk, Polizei und Rechtsstaat, S. 61ff.; Jessen, Polizei im Industrierevier, S. 32 und S. 57; Reiner, The Politics of the Police, S. 43. 151 Vgl. Lüdtke, Einleitung: Sicherheit und Wohlfahrt, S. 17; J. Zollmann, Koloniale Herrschaft und ihre Grenzen – Die Kolonialpolizei in Deutsch-Südwestafrika, Göttingen 2010, S. 48ff.; Liang, The Rise of Modern Police, S. 4. 152 Vgl. Eibich, Polizei, Gemeinwohl und Reaktion, S. 398ff. 153 Funk, Polizei und Rechtsstaat, S. 13. 154 Vgl. Iseli, Gute Policey, S. 10 f. 155 Vgl. Reemtsma, Organisationen mit Gewaltlizenz, S. 9ff.; R. Prätorius, Die Polizei als Organisation mit Gewaltlizenz – Möglichkeiten und Grenzen der Kontrolle, in: Kriminalistik, 55. Jg. (2001), Nr. 2, S. 117ff. 156 Vgl. M. R. Lepsius, Militärwesen und zivile Gesellschaft – Zur Institutionalisierung von Gewaltpotentialen in Friedenszeiten, in: U. Frevert [Hrsg.], Militär 1. Der Polizeibegriff 45 satz von Gewalt durch die Polizei sehr strengen Auflagen unterliegt, als geradezu irreführend. Zweckmäßiger sind Begriffsabgrenzungen, die vor allem auf die besonderen Merkmale und zentralen Aufgaben der Polizei abstellen, beispielsweise Robert Reiners Definition als „body of people patrolling public spaces in blue uniforms, with a broad mandate of crime control, order maintenance and some negotiable social service functions“157 oder Klaus Mladeks Abgrenzung als „uniformed forces for the prevention of crime and the enforcement of law“158. Allerdings sind auch diese Abgrenzungen aufgrund ihrer fehlenden Trennschärfe bei wissenschaftlichen Analysen nicht unproblematisch. Kritisch zu sehen ist zudem „die Hermetik eines [solchen] instrumentell-funktionalistischen Polizeiverständnisses“159, die auf einen ‚Polizeifetischismus‘160 hinausläuft und dabei die damit verbundenen gesellschaftlichen Interessen- und Herrschaftsstrukturen außer Acht lässt. Außerdem vernachlässigen sie, dass es auch nicht-uniformierte Polizeivollzugsbeamte (z. B. Angehörige der Kriminalpolizei) sowie nicht der Polizei angehörende uniformierte Sicherheitskräfte (z. B. Angestellte von privaten Sicherheitsunternehmen) gibt. Eine sehr zweckmäßige und treffende Abgrenzung findet man hingegen bei Rob I. Mawby, der Polizei definiert als „agency that can be distinguished in terms of its legitimacy, its structure and its function […]. Legitimacy implies that the police are granted some degree of monopoly within society by those with the power to so authorise […]. Structure implies that the police are an organised force, with some degree of specialisation and with a code of practice within which, for example, legitimate use of force is specified. […] Finally, function implies that the role of the police is concentrated on the und Gesellschaft, Stuttgart 1997, S. 359; M. Baldus, Staatliche Gewaltmonopole, in: D. Kugelmann, P. Rackow [Hrsg.], Prävention und Repression im Raum der Freiheit, der Sicherheit und des Rechts – Belastbarkeit der Konzepte von Strafe und Gefahrenabwehr zwischen Staat und EU, Baden Baden 2014, S. 11 f.; D. Grimm, Das staatliche Gewaltmonopol, in: W. Heitmeyer, J. Hagan [Hrsg.], Internationales Handbuch der Gewaltforschung, Wiesbaden 2002, S. 1303 f.; S. M. Wilz, Die Polizei als Organisation, in: in: M. Apelt, V. Tacke [Hrsg.], Handbuch Organisationstypen, Wiesbaden 2012 S. 113, S. 127. 157 Reiner, The Politics of the Police, S. 3. 158 Mladek, Police Forces, S. 3. 159 Funk, Polizei und Rechtsstaat, S. 14. 160 Vgl. Reiner, The Politics of the Police, S. 3 f. II. Theoretische Grundlagen 46 maintenance of law and order and the prevention and detection of offences“.161 In einem modernen, funktionierenden Staatswesen162 erfolgt die Legitimierung durch von den politischen Machthabern erlassene Gesetze. Ein entsprechendes Verständnis von Polizei als staatlichem Exekutivorgan, das öffentliche Sicherheit und Ordnung gemäß der Vorstellungen der jeweiligen Regierung gewährleistet und dabei innerhalb der von den jeweiligen Parlamenten geschaffenen gesetzlichen Rahmenbedingungen unmittelbaren Zwang und unmittelbare Gewalt ausüben darf, spiegelt sich auch in den gegenwärtigen deutschen Polizeigesetzen wider.163 Dementsprechend ist davon auszugehen, dass die Polizei als „eigenständige[n], professionelle[n], über das gesamte Territorium verteilte[n], quantitativ bedeutsame[n] und die staatliche und gesellschaftliche Ordnung umfassend garantierende[n] Institution“164 sowie als „Teil des [staatlichen] ‚Monopols legitimer physischer Gewaltsamkeit‘“165 primär ein Instrument staatlicher Herrschaft ist, während ihre Rolle als Sicherheitsorgan bzw. Gesetzeshüter sich daraus ableitet und daher sekundär ist. Dabei erfüllt die Polizei eine Vielzahl an unterschiedlichen Aufgaben. Ihr Kernaufgabenbereich lässt sich vereinfacht zusammenfassen als „regular uniform patrol of public space coupled with post hoc investigation of reported or discovered crime or disorder“166. Allerdings liegt ihr Arbeits- und Aufgabenschwerpunkt eindeutig im Bereich der ordnungserhaltenden Tätigkeiten, d. h. insbesondere des Streifendienstes, während kriminalistische, der Verbrechensbekämpfung im engeren Sinne dienende Tätigkeiten nicht nur von untergeordneter Bedeutung 161 Mawby, Models of policing, S. 17 f. (Hervorhebung im Original). 162 Zu nicht oder nur schlecht funktionierenden Staatswesen – d. h. schwachen oder gescheiterten Staaten – vgl. R. I. Rotberg, The Failure and Collapse of Nation-States: Breakdown, Prevention, and Repair, in: R. I. Rotberg [Hrsg.], When States Fail: Causes and Consequences, Princeton 2004, S. 2ff. 163 Vgl. z. B. § 1 Absatz 1 Satz 1 und 2 des Polizeigesetzes des Landes Nordrhein- Westfalen: „Die Polizei hat die Aufgabe, Gefahren für die öffentliche Sicherheit oder Ordnung abzuwehren (Gefahrenabwehr). Sie hat im Rahmen dieser Aufgabe Straftaten zu verhüten sowie vorbeugend zu bekämpfen und die erforderlichen Vorbereitungen für die Hilfeleistung und das Handeln in Gefahrenfällen zu treffen.“ Vgl. auch Wilz, Die Polizei als Organisation, S. 118. 164 Funk, Polizei und Rechtsstaat, S. 314. 165 Funk, Polizei und Rechtsstaat, S. 14. 166 Reiner, The Politics of the Police, S. 5. 1. Der Polizeibegriff 47 im Arbeitsalltag von Polizeibeamten sind, sondern zudem auch nur einen geringen Einfluss auf die Kriminalität zu haben scheinen.167 Im deutschsprachigen Raum wird in der Regel der staatliche Charakter der Polizei und ihre Funktion als Instrument staatlicher Herrschaft stärker betont als im angelsächsischen Raum, wo eher auf die gesellschaftliche Rolle der Polizei als Beschützerin der normativen Ordnung des Gemeinwesens168 bzw. als Sicherheitsorgan oder Gesetzeshüter abgestellt wird.169 Gleichwohl ist die letztgenannte Auffassung irreführend und basiert auf einer unzulässigen Gleichsetzung von Staat und Rechtsordnung. Dass diese Identität nicht selbstverständlich ist und (begrenzte) Monopole physischer Gewalt wie das der Polizei unter bestimmten Umständen – z. B. im Fall einer Diktatur – durchaus gesellschaftlich unerwünschte Konsequenzen haben können, verdeutlicht Hans-Joachim Heuers Metapher des ‚Janushaupts‘, mit der er solche Monopole charakterisiert: „sie funktionieren in einer Diktatur für die Interessendurchsetzung einer Clique […] und sind in einer Demokratie für die Schaffung von dauerhaft befriedeten Räumen verantwortlich“170. Und auch der US-Amerikaner Peter K. Manning erkennt an, dass die Polizei in erster Linie als staatliches Herrschaftsinstrument – und eben nicht als Gesetzeshüter – zu sehen ist, wenn er anmerkt, dass „the legitimation of the police in terms of legal authority flows from the power of the state and citizens‘ deference to it rather than from the law as an independent entity“171. Gleichwohl vernachlässigt man im englischsprachigen Schrifttum gerne die Rolle der Polizei als staatliches Herrschaftsinstrument und konzentriert sich eher auf die gesellschaftliche Rolle der Polizei als Beschützerin der normativen Ordnung eines Gemeinwesens.172 Diese unterschiedliche Auffassung der Rolle der Polizei im angelsächsischen im Vergleich zum deutschsprachigen Raum spiegelt sich allerdings nicht in den Zielen, der Organisation und den Aufgaben der Polizei wider, die sich in allen Industriestaaten erstaunlich ähneln.173 167 Vgl. M. Banton, The police as peace officers, in: T. Newburn [Hrsg.], Policing: Key Readings, Cullompton 2005 (Erstveröffentlichung: 1964), S. 132 f. 168 Vgl. Reiner, The Politics of the Police, S. 4 f. 169 Vgl. Funk, Polizei und Rechtsstaat, S. 13 f. 170 H.-J. Heuer, Entzivilisierung der Polizeiarbeit, in: Bundeskriminalamt [Hrsg.], Das Bundeskriminalamt stellt sich seiner Geschichte – Dokumentation einer Kolloquienreihe, Köln 2008, S. 69. 171 P. K. Manning, Police Work – The Social Organization of Policing, 2. Aufl., Prospect Heights 1997 (Erstveröffentlichung: 1977), S. 49. 172 Vgl. Reiner, The Politics of the Police, S. 4 f. 173 Vgl. Funk, Polizei und Rechtsstaat, S. 14. II. Theoretische Grundlagen 48 Der Charakter der Polizei als Instrument staatlicher Herrschaft wird erneut deutlich, wenn man sie gegenüber dem Militär als zweitem, wichtigem Träger des staatlichen Gewaltmonopols abgrenzt. Dem heutigen Sprachgebrauch folgend ist die Polizei für die innere Sicherheit – d. h. innerhalb der Staatsgrenzen – zuständig, während das das Militär für die äu- ßere Sicherheit jenseits der Staatsgrenzen sorgt.174 Gleichwohl ist gerade aus geschichtlicher Perspektive dem Begriff der ‚äußeren Sicherheit‘ angesichts der Vielzahl an militärischen Interventionen, die als Eroberungskriege ohne jeden Zweifel auf die Durchsetzung von Machtansprüchen abzielten und bei denen die Abwehr einer Bedrohung der eigenen Sicherheit höchstens am Rande eine Rolle spielte, mit Skepsis zu begegnen. Und auch in Bezug auf zahlreiche polizeiliche Aufgaben – z. B. im Bereich der Wirtschaftskriminalität oder bei der Überwachung des Straßenverkehrs – sind Zweifel angebracht, ob sie wirklich primär der Sicherheit der Bevölkerung und nicht eher der Aufrechterhaltung einer bestimmten, politisch gewünschten und gesetzlich legitimierten Form der gesellschaftlichen Ordnung dienen. Treffender erscheint daher eine Charakterisierung des Militärs als Instrument zur Durchsetzung von staatlichen Machtansprüchen im Ausland bzw. zur Abwehr von Machtansprüchen aus dem Ausland und der Polizei als Instrument zur Durchsetzung von staatlichen Machtansprüchen im Inland. Die sich daraus ergebende Notwendigkeit, im Rahmen einer historischen Analyse der Polizei stets auch die relevanten gesellschaftlichen Interessen- und Herrschaftsstrukturen zu berücksichtigen, betont Albrecht Funk, wenn er feststellt: „Polizeigeschichte ist nur als konkrete Herrschaftsgeschichte sinnvoll zu betreiben. Sie macht die Formen, in denen staatliche Macht und polizeiliche Gewalt organisiert sind, zum Gegenstand einer politischen Analyse.“175 Ein solches Polizeiverständnis, das die gesellschaftliche Rolle der Polizei als Instrument staatlicher Herrschaft in den Mittelpunkt der Analyse stellt, liegt daher auch der vorliegenden Dissertation zu Grunde. 174 Vgl. Lepsius, Militärwesen und zivile Gesellschaft, S. 360; W. Reinhard, Geschichte der Staatsgewalt – eine vergleichende Verfassungsgeschichte Europas von den Anfängen bis zur Gegenwart, 2. Aufl., München 2000, S. 363. 175 Funk, Polizei und Rechtsstaat, S. 14. 1. Der Polizeibegriff 49 Herrschaftssoziologische Grundlagen Um die Rolle der Polizei bei der Herstellung und Sicherung von staatlicher Herrschaft zu verstehen, ist die Berücksichtigung der vorliegenden herrschaftssoziologischen Erkenntnisse unerlässlich. Dabei zeigt schon ein flüchtiger Blick in die Literatur, dass der Polizei zweifelsohne eine wichtige Rolle in diesem Kontext zukommt. So sprechen beispielsweise Heinz-Gerhard Narr und Wolf-Dieter Narr von der Polizei als einem „Definitionselement staatlicher Herrschaft“176, während Frank Hatje sie als „Herrschaftsinstrument par excellence“ und „Repräsentation von Staatsgewalt177 bezeichnet. Nach Alf Lüdtke war die Polizei „Teil eines säkularen Prozesses, in dem sich Herrschaft in den Institutionen des »modernen Staates« […] ausformte“178. Um ein tieferes Verständnis dieses Prozesses zu erlangen, soll der Zusammenhang von Herrschaft und Polizei nun im Folgenden aus theoretischer Perspektive betrachtet werden, wobei bei diesem Thema natürlich die Soziologie die relevante Wissenschaftsdisziplin ist. Dabei wird zunächst auf die grundlegenden und für viele andere theoretische Ansätze maßgeblichen herrschaftssoziologischen Überlegungen von Max Weber eingegangen179, bevor dann Heinrich Popitz‘ Konzept von staatlicher Herrschaft als institutionalisierter Macht180 erläutert wird. Abschließend wird Alf Lüdtkes Verständnis von staatlicher Herrschaft als sozialer Praxis181 behandelt, das wiederum auf Pierre Bourdieus ‚Theorie der Praxis‘182 basiert. Auf eine ausführliche Erläuterung der historisch-soziolo- 2. 176 Vgl. H.-G. Haupt, W.-D. Narr, Vom Polizey-Staat zum Polizeistaat? Ein Forschungsbericht anhand neuerer Literatur, in: Neue Politische Literatur 23. Jg. (1978), S. 186. 177 Hatje, Repräsentationen der Staatsgewalt, S. 63 (Hervorhebung im Original). 178 Lüdtke, Einleitung: Sicherheit und Wohlfahrt, S. 29. 179 Vgl. M. Weber, Wirtschaft und Gesellschaft – Grundriss der verstehenden Soziologie, Tübingen 1922, § 16ff., http://www.textlog.de/7312.html (Zugriff: 12.2.2018). 180 Vgl. H. Popitz, Phänomene der Macht: Autorität – Herrschaft – Gewalt – Technik, Tübingen 1986. 181 Vgl. A. Lüdtke, Einleitung: Herrschaft als soziale Praxis, in: A. Lüdtke [Hrsg.], Herrschaft als soziale Praxis: historische und sozial-anthropologische Studien, Göttingen 1991, S. 9ff. 182 Vgl. P. Bourdieu, Entwurf einer Theorie der Praxis – auf der ethnologischen Grundlage der kabylischen Gesellschaft, Frankfurt a. M. 1976. II. Theoretische Grundlagen 50 gischen Ansätze von Norbert Elias183 und Michel Foucault184, die wegen ihrer fundamentalen Rolle in den soziologischen und gesellschaftspolitischen Diskursen der 1970er und 1980er Jahre als ‚Klassiker der zweiten Generation‘185 gelten, wird jedoch an dieser Stelle verzichtet. Auch wenn diese Ansätze grundlegende Erkenntnisse in Bezug auf die Entstehung und Entwicklung von gesellschaftlichen Herrschaftsstrukturen und staatlichen Machtpraktiken enthalten, so sind sie doch aufgrund ihrer oftmals sehr abstrakten Argumentation, ihres breiten Analysefokus und der nur rudimentären Berücksichtigung von konkreten staatlichen Institutionen und Praktiken für die in der vorliegenden Dissertation angestrebte historische Analyse der Rolle der Polizei im Rahmen von staatlicher Herrschaft wenig ergiebig.186 Staat, Macht und Herrschaft Um ein umfassendes Verständnis von staatlicher Herrschaft zu erlangen, ist es erforderlich, sich mit drei soziologischen Grundbegriffen auseinanderzusetzen, deren heutige Bedeutung ganz wesentlich von Max Weber (1864-1920) – dem wohl einflussreichsten deutschen Soziologen und Begründer der Herrschaftssoziologie – geprägt wurde. Dies sind zum einen der Staatsbegriff, zum anderen die „siamesische[n] Zwillinge“ Macht und Herrschaft, für die wegen ihrer engen inhaltlichen Verbindung in der Regel gilt: „[…] erwähnt man den einen, ist der andere gleich mitgemeint“187. a) 183 Vgl. insb. N. Elias, Über den Prozeß der Zivilisation, 2 Bände, Frankfurt a. M. 1976 (Erstveröffentlichung: 1939). 184 Vgl. insb. M. Foucault, Überwachen und Strafen – Die Geburt des Gefängnisses, Frankfurt a. M. 1976). 185 Zum Begriff vgl. R. Hettlage, Erving Goffmann – Ein Klassiker der zweiten Generation, in: R. Hettlage, K. Lenz [Hrsg.], Erving Goffman ein soziologischer Klassiker der 2. Generation? Stuttgart, Bern 1991, S. 385ff. und insb. S. 406ff. 186 Vgl. Knöbl, Polizei und Herrschaft, S. 21ff.; Lüdtke, Gemeinwohl, Polizei und Festungspraxis, S. 33ff. 187 D. Nogala, Polizei, avancierte Technik und soziale Kontrolle – Funktion und Ideologie technikbesetzter Kontrollstrategien im Prozeß der Rationalisierung von Herrschaft, Pfaffenweiler 1989, S. 117. Vgl. auch P. Imbusch, Macht und Herrschaft in der wissenschaftlichen Kontroverse, in: P. Imbusch [Hrsg.], Macht und Herrschaft – Sozialwissenschaftliche Theorien und Konzeptionen, 2. Aufl., Wiesbaden 2012, S. 9ff. 2. Herrschaftssoziologische Grundlagen 51 (1) Macht bezeichnet bei Max Weber „jede Chance, innerhalb einer sozialen Beziehung den eigenen Willen auch gegen Widerstreben durchzusetzen, gleichviel worauf diese Chance beruht“188. (2) Herrschaft umfasst demgegenüber „die Chance, für einen Befehl bestimmten Inhalts bei angebbaren Personen Gehorsam zu finden“189. (3) Staat definiert er schließlich als „politische[n] Anstaltsbetrieb […], wenn und insoweit sein Verwaltungsstab erfolgreich das Monopol legitimen physischen Zwanges für die Durchführung der Ordnungen in Anspruch nimmt“190. Staatliche Herrschaft zeichnet sich demzufolge durch Institutionalisierung und Legitimität aus, d. h. durch die dauerhafte Akzeptanz des Herrschaftsanspruchs der politischen Machthaber durch die Beherrschten. Dabei geht Max Weber vom Vorhandensein eines fundamentalen Konsenses zwischen Herrschern und Beherrschten in Bezug auf die Rechtmäßigkeit des staatlichen Gewaltmonopols aus, d. h. es „wird in die Herrschaft eingewilligt, weil sie legitim ist, anstatt daß sie legitim ist, weil sie die Einwilligung herbeiführt“191. Staatliche Gewalt und Legitimität sind bei ihm daher untrennbar miteinander verbunden.192 Dieses nicht hinterfragte Legitimitätseinverständnis vermeidet einerseits, dass staatliche Herrschaft auf die Frage reduziert wird, wie man im Konfliktfall die faktische Überlegenheit des Herrschers über die Beherrschten möglichst effektiv sicherstellt193, es stellt andererseits aber auch eine wichtige Schwachstelle des Weberschen Ansatzes dar, da man es durchaus hinterfragen könnte. So geht Alf Lüdtke angesichts der ungleichen Verteilung der gesellschaftlichen Ressourcen davon aus, dass dieses Legitimitätseinverständnis „weit eher ein frommer Wunsch oder bestenfalls eine Illusion von Herrschenden oder von Analytikern“194 ist. Dieser zwar zweifelsohne sehr wirkungsmächtige, aber zu Beginn des 20. Jahrhunderts von Max Weber bewusst abstrakt und relativ unspezifisch formulierte Ansatz wurde in der Folgezeit konkretisiert und auf die Praxis 188 Weber, Wirtschaft und Gesellschaft, § 16 Abs. 1 Satz 1. 189 Weber, Wirtschaft und Gesellschaft, § 16 Abs. 2 Satz 1. 190 Weber, Wirtschaft und Gesellschaft, § 17 Abs. 1 Satz 2 (Hervorhebung im Original). 191 A. W. Gouldner, ‚Disziplinäre‘ und ‚repräsentative‘ Bürokratie, in: R. Mayntz [Hrsg.], Bürokratische Organisation, 2. Aufl., Köln u. a., Berlin 1971, S. 435. 192 Vgl. Lüdtke, Gemeinwohl, Polizei und Festungspraxis, S. 28 f.; Funk, Polizei und Rechtsstaat, S. 15 f. 193 Vgl. Funk, Polizei und Rechtsstaat, S. 16. 194 Lüdtke, Gemeinwohl, Polizei und Festungspraxis, S. 29. II. Theoretische Grundlagen 52 staatlicher Herrschaft, d. h. auf die konkreten Herrschaftsbeziehungen zwischen den politischen Machthabern und der von diesen beherrschten Bevölkerung sowie auf die konkrete Ausgestaltung des Herrschaftsprozesses, übertragen.195 Aufschlussreich sind in diesem Zusammenhang insbesondere die beiden im Folgenden dargestellten, herrschaftssoziologischen Ansätze von Heinrich Popitz und Alf Lüdtke. Staatliche Herrschaft als institutionalisierte Macht Heinrich Popitz (1925-2002) bezeichnet Herrschaft zwar in Einklang mit Max Weber als institutionalisierte, geronnene Macht, allerdings richtet er sein Hauptaugenmerk insbesondere auf den Prozess dieser Institutionalisierung bzw. der Akkumulation von Macht. Dieser Akkumulationsprozess zeichnet sich seinem Ansatz zufolge durch zunehmende Entpersonalisierung, Formalisierung mittels Regeln, Verfahrensweisen und Ritualen und Integration des Machtverhältnisses in eine übergeordnete politische oder soziale Ordnung aus, die im Ergebnis zu einer weitgehenden Stabilisierung der Machtbeziehungen führen.196 Heinrich Popitz beschreibt diesen Institutionalisierungsprozess in einem Stufenmodell, das die folgenden fünf Stufen unterscheidet:197 (1) Sporadische Macht, die nur auf einen Einzelfall beschränkt ist. (2) Normierende Macht, bei der sich die Fügsamkeit der Beherrschten, z. B. durch die permanente Drohung mit Machtmitteln oder den Einsatz von dauerhaft wirkenden Machtmitteln, normativ verfestigt. (3) Positionalisierung von Macht, d. h. die Entstehung von überpersonalen Machtstellungen, in denen sich normative Macht verdichtet, was den Beginn von Herrschaft im engeren Sinne markiert. (4) Entstehung von Positionsgefügen der Herrschaft, d. h. eines arbeitsteiligen Herrschaftsapparates, das übertragbare Machtstellungen für eine grö- ßere Zahl an Herrschaftsfunktionären dauerhaft bereitstellt. b) 195 Vgl. Lüdtke, Gemeinwohl, Polizei und Festungspraxis, S. 27 f.; Popitz, Phänomene der Macht, S. 37 f.; Knöbl, Polizei und Herrschaft, S. 21 und 26. 196 Vgl. Popitz, Phänomene der Macht, S. 38ff.; Nogala, Polizei, avancierte Technik und soziale Kontrolle, S. 117; T. von Trotha, Koloniale Herrschaft – Zur soziologischen Theorie der Staatsentstehung am Beispiel des ‚Schutzgebietes Togo‘, Tübingen 1994, S. 1ff.; Vera, Die Kolonialpolizei, S. 223. 197 Vgl. Popitz, Phänomene der Macht, S. 42ff. 2. Herrschaftssoziologische Grundlagen 53 (5) Staatliche Herrschaft, d. h. veralltäglichte, zentralisierte Gebietsherrschaft mit Normsetzungs-, Rechtsprechungs- und Normdurchsetzungsmonopol, wie sie typisch für moderne Industriestaaten ist, als „Endstufe der Institutionalisierung von Macht“ 198. Auch wenn staatliche Herrschaft grundsätzlich darauf abzielt, Weisungen und Normsetzungen der politischen Machthaber im gesamten Staatsgebiet auch gegen Widerstand durchzusetzen199, so handelt es sich dabei aber keinesfalls um eine uneingeschränkte Macht, sondern vielmehr um eine unvollständige Monopolisierung, die insbesondere aufgrund der begrenzten Steuerungs- und Kontrollmöglichkeiten des Staates ein gewisses, im Zeitablauf veränderliches Maß an nichtstaatlicher Macht und nichtstaatliche Normen akzeptieren muss.200 Das besondere, charakteristische Merkmal von staatlicher Herrschaft ist aber insbesondere die Entstehung von dauerhaften, sich selbst reproduzierenden, von der Mehrzahl der Beherrschten als selbstverständlich empfundenen Herrschaftsstrukturen, und die veralltäglichte Machtausübung, bei der die Beherrschten akzeptieren, dass eine Vielzahl von Entscheidungen über ihre Lebensführung und ihren Alltag nicht von ihnen selbst, sondern von den politischen Machthabern und ihrem Machtapparat getroffen werden, und die letztlich Ausdruck der Vorteilhaftigkeit von staatlicher Herrschaft für die Beherrschten ist.201 Gleichwohl darf dabei nicht übersehen werden, dass eine solche veralltäglichte Machtausübung selbst in modernen Industriestaaten zwar in der Regel von der Bevölkerung mehrheitlich akzeptiert wird – aber eben nicht immer und nicht von jedem. Dies verweist auf die Notwendigkeit, über Machtmittel zu verfügen, die die politischen Entscheidungsträger in die Lage versetzen, Normen und Weisungen auch gegen Widerstand und gegebenenfalls mit Gewalt durchzusetzen. Dass die Polizei als zentraler Träger des staatlichen Gewaltmonopols im Innern202 eine zentrale Rolle bei der 198 Popitz, Phänomene der Macht, S. 67. 199 Vgl. Nogala, Polizei, avancierte Technik und soziale Kontrolle, S. 118. 200 Vgl. Popitz, Phänomene der Macht, S. 64ff. 201 Vgl. von Trotha, Koloniale Herrschaft, S. 2; G. Spittler, Streitregelung im Schatten des Leviathan – Eine Darstellung und Kritik rechtsethnologischer Untersuchungen, in: Zeitschrift für Rechtssoziologie, 1. Jg. (1980), S. 4ff.; T. von Trotha, Recht und Kriminalität – auf der Suche nach Bausteinen für eine rechtssoziologische Theorie des abweichenden Verhaltens und der sozialen Kontrolle, Tübingen 1982, S. 19ff.; Popitz, Phänomene der Macht, S. 65 f. 202 Vgl. Dams, Polizei, S. 50 f.; J.P. Reemtsma, Organisationen mit Gewaltlizenz – ein zivilisatorisches Grundproblem, in: M. Herrnkind, S. Scheerer [Hrsg.], Die Polizei als Organisation mit Gewaltlizenz, Münster u. a. 2003, S. 9ff. II. Theoretische Grundlagen 54 Durchsetzung dieses staatlichen Normdurchsetzungsmonopols spielt, ist offensichtlich.203 Staatliche Herrschaft als soziale Praxis Eine die ‚weichen‘ Formen von staatlicher Machtausübung noch stärker in den Fokus rückende Betrachtungsweise bietet der im deutschsprachigen Raum vor allem von Alf Lüdtke vertretene herrschaftssoziologische Ansatz, der Herrschaft als soziale Praxis betrachtet.204 Dieser basiert auf Pierre Bourdieus (1930-2002) ‚Theorie der Praxis‘205 und ihrem Kerngedanken, dass Menschen im alltäglichen Handeln in der Regel intuitiv, ohne zu reflektieren, den praktischen Gegebenheiten entsprechend handeln und auf diese Weise eine als selbstverständlich empfundene, kulturell bedingte Normalität – nämlich die soziale Praxis – herstellen.206 Eine entscheidende Rolle bei der Herausbildung der sozialen Praxis spielen zum einen der Habitus der handelnden Person und zum anderen das Feld als relevante soziale Umwelt.207 Der Habitus bezeichnet dabei das System dauerhafter Dispositionen, das sich ein sozialer Akteur auf der Grundlage der von ihm gemachten Erfahrungen aneignet und das sein Verhalten prägt.208 Diese Dispositionen legen das Handeln, Wahrnehmen oder Denken des Akteurs allerdings nicht deterministisch fest. Vielmehr bringt der oft als ‚Lebensstil‘ interpretierte Habitus, der in hohem Maße von der sozialen Herkunft des Akteurs abhängt, als Folge eines langwierigen, gesellschaftlich geprägten Lernprozesses bestimmte Handlungs-, Wahrnehmungs- und Denkschemata hervor. Diese lassen den Akteur in spezifischen Situationen mit hoher Wahrscheinlichkeit auf eine bestimmte Art und Weise handeln, ohne dass er sein Handeln aktiv reflektiert und sich über die Ursachen für sein Handeln bewusst ist. Typische, in der Literatur häufig thematisierte Ausprägungen des Habic) 203 Vgl. Knöbl, Polizei und Herrschaft, S. 26 f. 204 Vgl. Lüdtke, Einleitung: Herrschaft als soziale Praxis, S. 9ff. 205 Vgl. Bourdieu, Entwurf einer Theorie der Praxis. 206 Vgl. E. Barlösius, Pierre Bourdieu, 2. Aufl., Frankfurt a. M. u. a. 2011, S. 18 f. 207 Vgl. A. Vera, Interkulturelle Kompetenz und interkulturelles Lernen im Top Management der deutschen Polizei, in: ZDPol, 105. Jg. (2014), Nr. 4, S. 98 f.; W. Lempert, Soziologische Aufklärung als moralische Passion: Pierre Bourdieu – Versuch der Verführung zu einer provozierenden Lektüre, 2. Aufl., Wiesbaden 2011, S. 60ff. 208 Vgl. Bourdieu, Entwurf einer Theorie der Praxis, S. 164 f. 2. Herrschaftssoziologische Grundlagen 55 tus sind beispielsweise der Arbeiterhabitus, der Künstlerhabitus, der Studentenhabitus und der männliche bzw. weibliche Habitus.209 Untrennbar damit verknüpft ist das andere zentrale Element von Bourdieus Theorie sozialer Praxis, nämlich das Feld. Gemeint sind damit die autonomen sozialen Einheiten mit eigenem Referenzsystem und eigener Geschichte, aus denen sich die Gesellschaft zusammensetzt.210 Typische Beispiele hierfür sind das Feld der Wissenschaft, der Politik, der Industriearbeit oder der Kunst. Sie entstehen dadurch, „dass immer wieder vollzogene Praxisformen (…) sich in einem Feld sedimentieren können und damit zu einer vom Willen und Bewusstsein eines Individuums unabhängigen sozialen Tatsache werden“211. Dabei werden die Entstehung von Feldern, aber auch die Beziehungen zwischen Feldern sowie feldinterne Prozesse als Machtkämpfe betrachtet, an denen mit unterschiedlich viel Macht ausgestattete Akteure teilnehmen.212 Diese mit dem Feld verbundenen, äußeren Zwänge begründen im Zusammenwirken mit den inneren Zwängen des Habitus ein „‚Kräftefeld‘, in dem Macht durchgesetzt, Herrschaft begründet oder bezweifelt wird“213. Herrschaft als soziale Praxis findet in diesem ‚Kräftefeld‘ zwischen den internen, habituellen und den externen, feldbezogenen Zwängen statt und betont die zahlreichen und vielfältigen, oftmals wechselseitigen Abhängigkeiten zwischen Herrschern und Beherrschten sowie innerhalb der Gruppe der Herrscher bzw. der Beherrschten.214 Eine so verstandene Herrschaft enthält Doppeldeutigkeiten, Interpretations- und Entscheidungsspielräume und besteht nicht nur im Befehlen, Gehorchen oder Widerstehen, sondern auch im vorläufigen Hinnehmen, Ausweichen oder Ausnutzen durch den Beherrschten, aber auch in der Ausübung von ‚sanfter Gewalt‘ durch den Herrscher, z. B. in Form von Appellen an den Nationalstolz oder die Moral oder durch das Setzen von monetären oder nicht-monetären Anrei- 209 Vgl. Barlösius, Pierre Bourdieu, S. 76ff. 210 Vgl. B. Rehbein, G. Saalmann, Feld (champs), in G. Fröhlich, B. Rehbein [Hrsg.], Bourdieu Handbuch: Leben – Werk – Wirkung, Stuttgart u. a. 2009, S. 99ff. 211 W. R. Leenen, Interkulturelle Kompetenz – Theoretische Grundlagen, in W. R. Leenen, H. Grosch, A. Groß [Hrsg.], Bausteine zur interkulturellen Qualifizierung der Polizei, Münster 2005, S. 73. 212 Vgl. Barlösius, Pierre Bourdieu, S. 95ff. 213 Lüdtke, Einleitung: Herrschaft als soziale Praxis, S. 13. 214 Vgl. Lüdtke, Einleitung: Herrschaft als soziale Praxis, S. 13ff. II. Theoretische Grundlagen 56 zen, die „den Beherrschten die Illusion zwangloser Einwilligung [erlauben]“215. Überträgt man dies auf den Kontext von staatlicher Herrschaft, dann verdeutlicht dieser Ansatz die Begrenztheit staatlicher Machtausübung und die Notwendigkeit der Akzeptanz des staatlichen Machtanspruchs durch die Bevölkerung und steht somit in Einklang mit den Ausführungen zum herrschaftssoziologischen Stufenmodell von Heinrich Popitz im vorhergehenden Abschnitt. Alf Lüdtkes eher kulturwissenschaftlich geprägter Ansatz geht aber über die sich darin widerspiegelnde ‚Zweipoligkeit‘ zwischen Herrschern und Beherrschten hinaus, indem die mehr oder weniger subtilen Mechanismen, mit denen der Staat seinen Machtanspruch im Alltag durchzusetzen versucht, und die ambivalenten, sowohl Zustimmung als auch Widerstand implizierenden, alltäglichen Reaktionen der Bevölkerung darauf untersucht werden. Für die in der vorliegenden Dissertation angestrebte kulturgeschichtliche Analyse der Rolle der Polizei als Instrument staatlicher Herrschaft ergibt sich daraus die Notwendigkeit, genau solche „mehrdeutige[n] Gleichzeitigkeiten“ und „eigentümliche[n] ‚Gemengelagen‘“216 in der alltäglichen Polizeiarbeit im Deutschland der Zwischenkriegszeit in den Analysefokus zu rücken. Polizeisoziologische Grundlagen In der Soziologie findet man erstaunlicherweise relativ wenige Arbeiten, die sich explizit mit der Polizei beschäftigen.217 Dies ist durchaus verwun- 3. 215 Lüdtke, Gemeinwohl, Polizei und Festungspraxis, S. 34. 216 Lüdtke, Einleitung: Herrschaft als soziale Praxis, S. 18 (Hervorhebung im Original). 217 Zu den folgenden Ausführungen vgl. Vera, Organisation und Personalmanagement, S. 14ff. Vgl. auch Knöbl, Polizei und Herrschaft, S. 11 f.; E. Stölting, Geleitwort zur Soziologie der Polizei, in: J. Grutzpalk, A. Bruhn, J. Fatianova, F. Harnisch, C. Mochan, B. Schülzke, T. Zischke [Hrsg.], Beiträge zu einer vergleichenden Soziologie der Polizei, Potsdam 2009, S. 7ff.; J. Grutzpalk, A. Bruhn, J. Fatianova, F. Harnisch, C. Mochan, B. Schülzke, T. Zischke, Einleitung und Begriffsbestimmung, in: J. Grutzpalk, A. Bruhn, J. Fatianova, F. Harnisch, C. Mochan, B. Schülzke, T. Zischke [Hrsg.], Beiträge zu einer vergleichenden Soziologie der Polizei, Potsdam 2009, S. 13; T. Ohlemacher, D. Boumans, A. Buchner, D. Sögding, Empirische Polizeiforschung: Auf dem Weg zum Pluralismus der Perspektiven, Disziplinen und Methoden, in: H.-J. Lange [Hrsg.], Die Polizei der Gesellschaft – Zur Soziologie der Inneren Sicherheit, Opladen 2003, S. 378ff.; H.-J. Lange, Polizeiforschung, Polizeiwissenschaft 3. Polizeisoziologische Grundlagen 57 derlich, da das staatliche Gewaltmonopol, spätestens seitdem Max Weber es in den Mittelpunkt seiner Definition des Staates gerückt hat, zweifelsohne zu den wichtigsten Konzepten der Soziologie zählt.218 Wolfgang Knöbl stellt hierzu treffend fest: „Max Webers »Formel« vom Gewaltmonopol als dem entscheidenden Definitionsmerkmal des modernen Staates wurde also viel häufiger zitiert als wirklich zum Gegenstand von Untersuchungen gemacht.“219 Gleichwohl gibt es natürlich eine beachtliche Anzahl an soziologischen Studien, die explizit die Polizei in den Analysefokus nehmen und die in der Literatur daher üblicherweise als ‚polizeisoziologisch‘ charakterisiert werden. Eine solche Polizeisoziologie definiert Günter Endruweit als „empirische Wissenschaft über die Wechselbeziehungen zwischen Gesellschaft und Polizei mit systematisch erweiterter Theorie und darauf bezogener methodischer Überprüfung sowie einem daraus entstehenden immer vollständigeren und immer aktuelleren Wissensbestand nicht nur über die deutsche Polizei“220. Die dazugehörigen wissenschaftlichen Arbeiten unterteilt er in die vier folgenden Forschungsstränge:221 (1) Organisationssoziologische Studien: Im Mittelpunkt stehen hier die organisatorischen Aspekte der Polizei, z. B. die Organisationsziele, die Organisationsstrukturen und -prozesse, die Aufgaben oder die Instrumente der Polizei. (2) Politiksoziologische Studien: Diese untersuchen insbesondere die Bedeutung, die Funktionen und die Wirkungen der Polizei in der Gesellschaft sowie die Beziehungen zwischen der Polizei und ihrer Umwelt. (3) Berufssoziologische Studien: Betrachtet wird hier der Polizeiberuf – z. B. die typischen Karrieremuster und -verläufe, die Arbeitsbedingungen oder die Vergütung von Polizeibeamten. (4) Rechtssoziologische Studien: Diese untersuchen die Rolle der Polizei bei der Durchsetzung von rechtlichen Regelungen. oder Forschung zur Inneren Sicherheit? – Über die Etablierung eines schwierigen Gegenstandes als Wissenschaftsdisziplin, in: H.-J. Lange [Hrsg.], Die Polizei der Gesellschaft – Zur Soziologie der Inneren Sicherheit, Opladen 2003, S. 428. 218 Vgl. Grimm, Das staatliche Gewaltmonopol, S. 1299. 219 Knöbl, Polizei und Herrschaft, S. 11. 220 G. Endruweit, Resümee der Polizeisoziologie – als Versuch der Etablierung einer neuen speziellen Soziologie, in: H.-J. Lange [Hrsg.], Die Polizei der Gesellschaft – Zur Soziologie der Inneren Sicherheit, Opladen 2003, S. 408. 221 Vgl. Endruweit, Resümee der Polizeisoziologie, S. 400 f. H.-J. Lange unterscheidet hingegen lediglich zwischen binnensoziologischen Studien und Arbeiten, die die Stellung der Polizei in der Gesellschaft untersuchen; vgl. Lange, Polizeiforschung, S. 429. II. Theoretische Grundlagen 58 Aus wissenschaftstheoretischer Perspektive stellt die Polizeisoziologie allerdings nach überwiegender Meinung keine eigenständige soziologische Teildisziplin, sondern lediglich einen – durchaus etablierten – Forschungszweig der Soziologie dar. Begründet wird dies insbesondere mit erheblichen Defiziten bei der theoretischen Fundierung, bei der Systematik und beim Feldzugang. Dementsprechend kommt Günter Endruweit in Bezug auf die Etablierung einer eigenständigen Polizeisoziologie zu der pessimistischen Einschätzung, dass „wir noch weit entfernt davon [sind], wohl noch nicht einmal auf dem Wege“222. Hans-Jürgen Lange geht sogar so weit, zu behaupten, dass ihre Etablierung bisher nicht nur nicht gelungen, sondern sogar gescheitert ist.223 Unabhängig von ihrem wissenschaftstheoretischen Status bietet die Polizeisoziologie aber zweifelsohne eine Vielzahl an Forschungsergebnissen und liefert wichtige und interessante Erkenntnisse, die im Rahmen der vorliegenden Dissertation nicht unbeachtet bleiben dürfen. Im Folgenden sollen daher diejenigen Forschungsansätze erörtert werden, die sich besonders gut für eine kulturgeschichtliche Analyse der Polizei als Instrument staatlicher Herrschaft eignen. Orientiert man sich an der oben dargestellten Klassifizierung der polizeisoziologischen Forschungsstränge, dann handelt es sich dabei hauptsächlich um politik- und organisationssoziologische Ansätze, wobei wegen der fehlenden trennscharfen Abgrenzung der vier Forschungsstränge natürlich auch berufs- und rechtssoziologische Aspekte miteinfließen. Mit dem modernisierungstheoretischen und dem konflikttheoretischen Ansatz werden zunächst die beiden wichtigsten Ansätze der angelsächsischen Polizeisoziologie erörtert, bevor dann der die deutschsprachige Polizeisoziologie und Polizeigeschichtsschreibung dominierende herrschaftstheoretische Ansatz betrachtet wird. Diese drei Ansätze haben gemeinsam, dass sie politiksoziologisch geprägt sind und sich somit primär mit den Ursachen und Bedingungen für die Entstehung der Polizei im Laufe des 19. Jahrhunderts und mit der damit zusammenhängenden gesellschaftlichen Funktion der Polizei beschäftigen. Anschließend werden mit dem dramaturgischen und dem organisationskulturellen Ansatz zwei organisationssoziologisch geprägte Konzepte vorgestellt, die dementsprechend versuchen, die Aufgaben und Ziele der Polizei als Organisation und das Verhalten ihrer Mitglieder, d. h. der Polizeibeamten, zu erklären. 222 Endruweit, Resümee der Polizeisoziologie, S. 409. 223 Vgl. Lange, Polizeiforschung, S. 429 f. 3. Polizeisoziologische Grundlagen 59 Der modernisierungstheoretische Ansatz Die Modernisierungstheorie beschäftigt sich mit den wesentlichen, langfristigen gesellschaftlichen Entwicklungsprozessen in der Moderne und geht dabei von einer zielgerichteten, zwangsläufigen Entwicklung von Gesellschaften aus, die in einem traditionellen, vorindustriellen Zustand ihren Ausgang nimmt und letztlich in die Entstehung von industrialisierten, demokratisierten, säkularisierten und bürokratisierten Gesellschaften mündet.224 Überträgt man die Grundgedanken dieses auf gesamtgesellschaftliche Zusammenhänge ausgerichteten, theoretischen Ansatzes auf die Entwicklung der Polizei, dann spricht man vom modernisierungstheoretischen Ansatz der Polizeisoziologie. Dieser postuliert, dass die Entstehung der modernen Polizei in Mittel- und Westeuropa in der ersten Hälfte des 19. Jahrhunderts eine Reaktion auf die gesellschaftlichen Probleme und Herausforderungen der Industrialisierung war.225 Dabei versteht man unter ‚Industrialisierung‘ den seit der zweiten Hälfte des 18. Jahrhunderts zunächst in Großbritannien und später auch in anderen Regionen stattfindenden Transformationsprozess, der auf der Grundlage von technisch-wissenschaftlichem Fortschritt, gewerblicher Massenproduktion in Fabriken und eines kapitalistisch-marktwirtschaftlichen Systems vormoderne, agrarische in industriell geprägte Gesellschaften umwandelte.226 Aus polizeisoziologischer Sicht war dabei vor allem die damit verbundene Entstehung von städtischen Ballungsräumen mit hoher Bevölkerungsdichte relevant, die zu steigender Kriminalität und gesellschaftlichen Unruhen führte, denen man durch die Einrichtung einer Polizei als „mehr oder minder neutrales Instrument“227 staatlicher Herrschaft zu begegnen suchte. Die Polizei agierte dabei stets uneigennützig und unparteiisch, so dass alle – und damit auch die unteren – Gesellschaftsschichten gleichermaßen von ihr profia) 224 Vgl. T. Mergel, Modernisierung, in: Institut für Europäische Geschichte [Hrsg.], Europäische Geschichte Online, Mainz 2011, Abs. 1 f., http://www.ieg-e go.eu/mergelt-2011-de (Zugriff: 12.2.2018); J. Berger, Was behauptet die Modernisierungstheorie wirklich – und was wird ihr nur unterstellt? in: Leviathan, 24. Jg. (1996), Nr. 1, S. 45-62. Zu den folgenden Ausführungen vgl. Vera, Organisation und Personalmanagement, S. 17 f. 225 Vgl. Knöbl, Polizei und Herrschaft, S. 57; T. A. Critchley, A History of Police in England and Wales, 2. Aufl., London 1978, S. 21. 226 Vgl. z. B. H.-W. Hahn, Die Industrielle Revolution in Deutschland, München 2011, S. 1ff.; H. Glaser, Wer entfesselte Prometheus? in: H. Glaser [Hrsg.], Maschinenwelt und Alltagsleben – Industriekultur in Deutschland vom Biedermeier bis zur Weimarer Republik, Frankfurt a. M. 1981, S. 32ff. 227 Knöbl, Polizei und Herrschaft, S. 57. II. Theoretische Grundlagen 60 tierten und Widerstand gegen die Polizei irrational sein musste.228 Diese etwas naiv und sehr ‚polizeifreundlich‘ anmutende Sichtweise der Polizei als „inevitable and unequivocally beneficient institution“229 hat bis in die 1970er Jahre hinein die wissenschaftliche Auseinandersetzung mit der Polizei nicht nur im angelsächsischen Raum dominiert230, so dass Robert Reiner den modernisierungstheoretischen Ansatz der Polizei auch als „cop-sided view“ bzw. „orthodox view“231 bezeichnet. Der modernisierungstheoretische Ansatz der Polizeisoziologie befindet sich allerdings – wie auch die Modernisierungstheorie insgesamt232 – seit den 1970er Jahren „in der Defensive“233 und gilt heutzutage sicherlich nicht mehr als wichtigster Erklärungsansatz für die Entstehung und Entwicklung der Polizei. Neben dem ideologischen Charakter dieses Ansatzes und den Defiziten bei seiner theoretischen Fundierung haben sich insbesondere seine auf einem unspezifischen, als neutral verstandenen Effizienzbegriff basierende Argumentation sowie die unzulässige Vernachlässigung von Verteilungs- und Machtaspekten als zentrale Schwachstellen modernisierungstheoretischer Arbeiten erwiesen.234 So sind beispielsweise polizeiliche Strategien, die auf einen besseren Eigentumsschutz oder eine stärkere Reglementierung des Straßenverkehrs abzielen, nicht per se effizient oder ineffizient, sondern stets vor dem Hintergrund der Interessen der betroffenen Bevölkerungsgruppen bzw. der gesellschaftlichen Eigentumsverhältnisse zu deuten. So dürften z. B. wohlhabende Immobilienbesitzer und Autofahrer andere polizeilichen Strategien bevorzugen als Arbeitslose, die sich weder Wohneigentum noch ein Auto leisten können. Die offensichtliche Naivität und ideologische Prägung des modernisierungstheoretischen Ansatzes der Polizeisoziologie zeigte sich nicht zuletzt in der geringen Akzeptanz der Polizei in den unteren Bevölkerungsschichten im 19. Jahrhundert, die sich sehr anschaulich in pejorativen Bezeichnungen für die Polizei – wie Robert D. Storchs und F. Engels oft zitierte „plague of blue lo- 228 Vgl. Reiner, The Politics of the Police, S. 42ff.; Critchley, A History of Police, S. 28. 229 Reiner, The Politics of the Police, S. 39. 230 Vgl. Reinke, Das Amt der Polizei, S. 21. 231 Reiner, The Politics of the Police, S. 40. 232 Vgl. Mergel, Modernisierung, Abs. 2ff. 233 Knöbl, Polizei und Herrschaft, S. 370. 234 Vgl. Knöbl, Polizei und Herrschaft, S. 58. 3. Polizeisoziologische Grundlagen 61 custs“235 – widerspiegelt und die sich kaum in Einklang bringen lässt mit der Vorstellung einer Polizei, die als neutrales Herrschaftsinstrument im gesamtgesellschaftlichen Interesse für Sicherheit und Ordnung sorgt. Der konflikttheoretische Ansatz Als Erwiderung auf die eben dargestellte Kritik am modernisierungstheoretischen Ansatz der Polizeisoziologie entstand in Laufe der 1970er Jahre ein marxistisch geprägter Erklärungsansatz, der die Entstehung der modernen Polizei im 19. Jahrhundert auf andere Ursachen zurückführte.236 Als zentraler Meilenstein gilt hierbei sicherlich die Veröffentlichung von Robert D. Storchs und F. Engels bereits oben erwähntem Aufsatz im Jahr 1975, der den so genannten konflikttheoretischen Ansatz der Polizeisoziologie begründete und zu den meistzitierten Publikationen in diesem Forschungsfeld gehört.237 Der Grundgedanke dieses Ansatzes besagt, dass die Polizei ein Instrument der herrschenden Klassen zur Erhaltung ihrer Macht und zur Unterdrückung der Arbeiterklasse bzw. der unteren Gesellschaftsschichten ist – und damit alles andere als ein neutrales Instrument staatlicher Herrschaft.238 Robert Reiner bezeichnet ihn daher auch als „revisionist account“239, dessen Zielsetzung die Korrektur der oben erläuterten ‚cop-sided view‘ war. Die Vertreter des konflikttheoretischen Ansatzes gehen dementsprechend auch davon aus, dass die Entstehung einer modernen Polizei in der ersten Hälfte des 19. Jahrhunderts keinesfalls ein „inevitable march towards progress“ war, sondern vielmehr „a protracted and painful struggle, in the face of bitter resistance and smouldering hostility“240. Ursächlich für die Einrichtung von modernen Polizeien in allen Industriestaaten in Laufe des 19. Jahrhunderts waren dem konflikttheoretischen Ansatz zufolge weniger die im Zuge der Industrialisierung zunehmende Kriminalität als die b) 235 R. D. Storch, F. Engels, »The plague of blue locusts«: police reform and popular resistance in northern England 1840-1857, in: International Review of Social History, 20. Jg. (1975), Nr. 1, S. 61. 236 Vgl. Newburn, Introduction, S. 5; Reiner, The Politics of the Police, S. 40. Zu den folgenden Ausführungen vgl. Vera, Organisation und Personalmanagement, S. 18ff. 237 Vgl. Storch, Engels, The plague of blue locusts, S. 61ff. 238 Vgl. Reiner, The Politics of the Police, S. 40, S. 47ff. 239 Reiner, The Politics of the Police, S. 47. 240 Reiner, The Politics of the Police, S. 39 f. II. Theoretische Grundlagen 62 kapitalistisch-marktwirtschaftlichen Rahmenbedingungen des Industrialisierungsprozesses und die damit einhergehenden Klassenkonflikte.241 Ausgehend vom Gedanken, dass die vorindustriellen Arbeits- und Lebensbedingungen der unteren Gesellschaftsschichten mit den technisch-organisatorischen Anforderungen der Unternehmen der Industriegesellschaft unvereinbar waren, gehen die Vertreter dieses Ansatzes davon aus, dass die Errichtung einer öffentlich finanzierten, bürokratisch organisierten Polizei und insbesondere ihre flächendeckende Präsenz dazu diente, die gesellschaftlichen Rahmenbedingungen an die kapitalistischen Produktionsbedingungen anzupassen.242 Dabei wurden zunächst bestimmte Verhaltensweisen, die in vorindustriellen Zeiten noch üblich und legal waren, zunächst auf der legislativen Ebene kriminalisiert. 243 Dazu gehörten z. B. aufrührerische Proteste, die in vorkapitalistischen Zeiten eine proto-demokratische Form der Kommunikation zwischen den unteren und den oberen Klassen darstellten und die im Laufe des 19. Jahrhunderts dann zu einer Gefährdung der öffentlichen Ordnung umdefiniert wurden. Der Polizei kam die Aufgabe zu, diese ‚neuen‘ Formen der Kriminalität zu bekämpfen und ein auf konservativen Werten und strenger Disziplin beruhendes Verständnis von öffentlicher Ordnung durchzusetzen, das den Vorstellungen der herrschenden Klassen entsprach und eine wichtige Voraussetzung für die Funktionsfähigkeit einer kapitalistischen Industriegesellschaft waren.244 Darüber hinaus wurde die Polizei nach Ansicht der Vertreter des modernisierungstheoretischen Ansatzes der Polizeisoziologie von den herrschenden Klassen und insbesondere von der industriellen Oberschicht dazu benutzt, um „die als zunehmend fremd und bedrohlich empfundenen Lebensgewohnheiten proletarischer und subproletarischer Gruppen“245 zu 241 Vgl. Knöbl, Polizei und Herrschaft, S. 58ff. 242 Vgl. Reiner, The Politics of the Police, S. 48. 243 Vgl. E. J. Hobsbawm, Primitive Rebels – Studies in Archaic Forms of Social Movement in the 19th and 20th Centuries, Manchester 1959, S. 108ff.; M. Neocleous, The Fabrication of Social Order – A Critical Theory of Police Power, London, Sterling 2000, S. 1ff.; M. Neocleous, Theoretical Foundations of the »New Police Science«, in: M. D. Dubber, M. Valverde [Hrsg.], The New Police Science, Stanford 2006, S. 29ff.; P. Cohen, Policing the Working Class City – From Deviancy Theory to Marxism, in: B. Fine, R. Kinsey, J. Lea, S. Picciotto, J. Young [Hrsg.], Capitalism and the Rule of Law, London 1979, S. 120 f. 244 Vgl. S. Spitzer, A. T. Scull, Social Control in Historical Perspective, in: D. F. Greenberg [Hrsg.], Corrections and Punishment, Beverly Hills 1977, S. 277. 245 Knöbl, Polizei und Herrschaft, S. 59. 3. Polizeisoziologische Grundlagen 63 kontrollieren und in ihrem Sinne zu verändern. Hier wird deutlich, dass dieser Ansatz sicherlich auch zu einer etwas einseitigen, möglicherweise überkritischen Analyse der gesellschaftlichen Bedeutung und Funktion der Polizei führt, die sich nicht zuletzt in Robert Reiners polemisch gemeinter Bezeichnung als „lop-sided view“246 widerspiegelt. So erscheint die Annahme, dass die Entstehung der Polizei auf ein „diffuse[s] Gefühl der Bedrohung kultureller Standards“247 der gesellschaftlichen Oberschicht zurückzuführen sein könnte, durchaus fragwürdig. Deutlich plausibler ist hingegen die Annahme eines realen Gefahrenszenarios für das industrielle Bürgertum, das im 19. Jahrhundert in der Regel in einem urbanen Umfeld und damit geografisch in relativer Nähe zu den unteren Bevölkerungsschichten lebte. Dementsprechend war ihr Besitz – beispielsweise Industrieanlagen oder Handelswaren – stärker von Diebstahl und Zerstörung bedroht als in vorindustriellen Zeiten. Angesichts der unbestreitbaren kriminalsoziologischen Tatsache, dass kriminelles Verhalten in den unteren, ärmeren Gesellschaftsschichten häufiger vorkommt als in den oberen248, war die Einrichtung einer flächendeckend präsenten Polizei daher zweifelsohne auch den konkreten Schutzbedürfnissen des industriellen Bürgertums geschuldet.249 Der konflikttheoretische Ansatz der Polizeisoziologie leidet zudem – wie auch schon der weiter oben erläuterte modernisierungstheoretische Ansatz – unter den Defiziten seines theoretischen Fundaments, d. h. in diesem Fall der marxistischen Konflikttheorie. Dementsprechend kann dieser polizeisoziologische Ansatz vor allem aufgrund seiner einseitigen, deterministischen Konfliktorientierung und seiner mangelnden Berücksichtigung der heterogenen Zusammensetzung von Klassen nicht überzeugend erklären, warum die Polizei von einem beachtlichen Teil auch der unteren Bevölkerungsschichten akzeptiert und respektiert wurde und warum diese Akzeptanz im Laufe des 19. und 20. Jahrhunderts eher zu- als abnahm.250 Dennoch hat der konflikttheoretische Ansatz der Polizeisoziologie, indem es 246 Reiner, The Politics of the Police, S. 47. 247 Knöbl, Polizei und Herrschaft, S. 59 (Hervorhebung im Original). 248 Vgl. z. B. T. Ohlemacher, How far can you go? Empirische Sozialforschung, Kriminologie und Kriminalisierung – Das Beispiel Armut und Kriminalität, in: W. Ludwig-Mayerhofer [Hrsg.], Soziale Ungleichheit, Kriminalität und Kriminalisierung, Wiesbaden 2000, S. 203ff. 249 Vgl. M. Brogden, The Police: Autonomy and Consent, London, New York 1982, S. 49 f.; Reinke, Das Amt der Polizei, S. 22. 250 Vgl. Knöbl, Polizei und Herrschaft, S. 60; Reiner, The Politics of the Police, S. 55. II. Theoretische Grundlagen 64 die fundamentale Rolle von gesellschaftlichen Interessen und Machtverteilungsfragen in den Analysefokus rückte, einen wesentlichen Beitrag zur Entwicklung einer „much richer history of policing arrangements”251 und zu einem besseren Verständnis der gesellschaftlichen Funktion der Polizei und ihrer Rolle im Rahmen von staatlicher Herrschaft geleistet.252 Der herrschaftstheoretische Ansatz Im Gegensatz zur englischsprachigen Polizeisoziologie, die vor allem von den beiden eben erörterten, modernisierungs- und konflikttheoretischen Ansätzen geprägt worden ist, wird die deutsche Polizeisoziologie im Allgemeinen und die deutsche Polizeigeschichtsschreibung im Besonderen von Max Weber und dem auf seinen theoretischen Erkenntnissen basierenden, bereits weiter oben behandelten herrschaftssoziologischen Ansätzen dominiert.253 Den Ausgangspunkt dieser Ansätze bildet die Annahme, dass der Staat über das Monopol der legitimen Ausübung von Gewalt verfügt und dass dies sein zentrales Definitionsmerkmal ist.254 Eine direkte Bezugnahme auf die Polizei findet sich allerdings weder bei Max Weber noch bei den meisten auf diesem Ansatz beruhenden herrschaftssoziologischen Arbeiten. In der Regel wird dabei die gesellschaftliche Funktion der Polizei nicht eingehend thematisiert, sondern „als bare Selbstverständlichkeit behandelt“255. Es gibt aber durchaus theoretische Ansätze, die das Webersche Paradigma explizit auf die Polizei übertragen. Mit Egon Bittner und Albrecht Funk werden im Folgenden die beiden wohl bekanntesten Ansätze vorgestellt. Gerade in der englischsprachigen Polizeisoziologie nehmen die Arbeiten von Egon Bittner (1921-2011) eine zentrale Rolle ein. Er führt die Entstehung der modernen Polizei in der ersten Hälfte des 19. Jahrhunderts auf die Bemühungen zurück, den Einsatz von physischer Gewalt in einer Gec) 251 Newburn, Introduction, S. 5. 252 Vgl. Reiner, The Politics of the Police, S. 55. 253 Vgl. J.-P. Brodeur, Gewalt und Polizei, in: W. Heitmeyer, J. Hagan [Hrsg.], Internationales Handbuch der Gewaltforschung, Wiesbaden 2002, S. 262; Knöbl, Polizei und Herrschaft, S. 61. Zu den folgenden Ausführungen vgl. Vera, Organisation und Personalmanagement, S. 21ff. 254 Vgl. Weber, Wirtschaft und Gesellschaft, § 17 Abs. 1 Satz 2 und Abs. 4 (Nr. 2). Vgl. auch Lüdtke, Gemeinwohl, Polizei und Festungspraxis, S. 28; Brodeur, Gewalt und Polizei, S. 262. 255 Lüdtke, Gemeinwohl, Polizei und Festungspraxis, S. 31. 3. Polizeisoziologische Grundlagen 65 sellschaft einzuschränken. Um dieses Ziel zu erreichen, wird das Recht zur Anwendung von physischer Gewalt weitgehend der Polizei, d. h. einer öffentlichen, von einem demokratisch gewählten Parlament legitimierten und kontrollierten Institution, übertragen.256 Das Aufgabenfeld der Polizei umschreibt Egon Bittner folgendermaßen: „My thesis is that police are empowered and required to impose or, as the case may be, coerce a provisional solution upon emergent problems without having to brook or defer to opposition of any kind, and that further, their competence to intervene extends to every kind of emergency, without any exceptions whatever.“257 Die Polizei hat dieser sehr weiten Abgrenzung zufolge insbesondere Probleme zu lösen, bei denen der Einsatz von unmittelbarem Zwang bis hin zu physischer Gewalt erforderlich sein kann, und ist demzufolge „nichts anderes als ein Mechanismus zur Verabreichung situationell gerechtfertigter Gewalt in der Gesellschaft“258. In diesem Sinne betrachtet er die „Capacity to Use Force as the Core of the Police Role“259. Trotz dieser ‚martialisch‘ anmutenden Funktionsbeschreibung darf aber nicht übersehen werden, dass Egon Bittner damit keinesfalls meinte, dass Polizeiarbeit regelmäßig die Konfrontation mit oder sogar den Einsatz von Gewalt impliziert. Vielmehr definieren die potenziell gewaltsamen Konflikte lediglich die allgemeine Zuständigkeit der Polizei, die durchaus ein breites und vielfältiges Aufgabenspektrum umfasst. In diesem Sinne stellt er fest, dass Polizeibeamte „may be required to do the work of thief-catchers and of nurses, depending on the occasion“260. Gleichwohl stellt die Tatsache, dass der Polizei diesem theoretischen Ansatz zufolge ausschließlich die Zuständigkeit für die Bereinigung von potenziell gewaltsamen Konflikten zukommt, aus herrschaftssoziologischer Sicht trotz der erheblichen Ermessensspielräume der Polizei bei der Frage, ob der Einsatz von Gewalt erforderlich ist bzw. sein könnte, aber auch eine gewisse Einschränkung ihrer 256 Vgl. E. Bittner, Aspects of Police Work, Boston 1990 (Erstveröffentlichung des betreffenden Kapitel: 1970), S. 102ff. 257 E. Bittner, Florence Nightingale in pursuit of Willie Sutton: a theory of the police, in: T. Newburn [Hrsg.], Policing: Key Readings, Cullompton 2005 (Erstveröffentlichung: 1990), S. 150. 258 Brodeur, Gewalt und Polizei, S. 264. 259 E. Bittner, Capacity to Use Force as the Core of the Police Role, in: V. E. Kappeler [Hrsg.], Police and Society: Touchstone Readings, Long Grove 1995, S. 127. 260 Bittner, Florence Nightingale in pursuit of Willie Sutton, S. 150. II. Theoretische Grundlagen 66 Rolle im Rahmen von staatlicher Herrschaft dar, die gerade im Vergleich zum im Folgenden erörterten Ansatz von Albrecht Funk deutlich wird. Im deutschsprachigen Raum gilt Albrecht Funk als „[h]erausragender Vertreter“261 des auf dem Weberschen Paradigma aufbauenden, herrschaftstheoretischen Ansatzes, das er allerdings angesichts seiner weiter oben angesprochenen Defizite um marxistische Elemente ergänzte, so dass man von einer Synthese dieser beiden Ansätze sprechen kann. In seinem zentralen Werk ‚Polizei und Rechtsstaat‘, das sich mit der Entwicklung der preußischen Polizei zwischen 1848 und 1914 beschäftigt, geht er davon aus, dass die gesellschaftlichen Selbstorganisierungskräfte in kapitalistischen Gesellschaften im Laufe der Zeit verkümmern, so dass staatliche Herrschaft nur auf der Grundlage von bürokratischen Strukturen gewährleistet werden kann.262 Diese Defizite des Kapitalismus führten im Laufe des 19. Jahrhunderts in allen Industriegesellschaften zur Einrichtung einer „bürokratisch-exekutive[n] Polizei, die die Verwaltung der öffentlichen Sicherheit und Ordnung und ihre Exekution systematisch verband“ und so „das staatliche Gewaltmonopol in den gesellschaftlichen Alltag hinein verlagert[e]“263. Trotz ihrer bürokratischen Prägung bleibt der Einsatz von physischer Gewalt durch die Polizei oder zumindest die Drohung damit aber weiterhin ein wesentliches Element der Polizeiarbeit. Für die Sicherung staatlicher Herrschaft ist es nach Ansicht von Albrecht Funk aber wesentlich wichtiger, dass ein möglichst großer Teil der Bevölkerung die Unterwerfung unter das staatliche Gewaltmonopol verinnerlicht und die Legitimität der Polizeigewalt nicht mehr hinterfragt.264 Im Ergebnis führt dieser bürokratische Charakter der Polizei aus herrschaftssoziologischer Sicht aber zu einer deutlich umfassenderen Rolle der Polizei im Rahmen von staatlicher Herrschaft als bei Egon Bittner. Die markanten Unterschiede zwischen Egon Bittners Auffassung der Polizei als „Mechanismus zur Verabreichung situationell gerechtfertigter Gewalt in der Gesellschaft“265 und Albrecht Funks „bürokratisch-exekutive[r] Polizei“266 verdeutlichen, dass der auf Max Weber zurückgehende herrschaftstheoretische Ansatz und die untrennbar damit verbundene Funktion der Polizei als zentrales Instrument staatlicher Herrschaft mit 261 Knöbl, Polizei und Herrschaft, S. 61. 262 Vgl. Knöbl, Polizei und Herrschaft, S. 62; Funk, Polizei und Rechtsstaat, S. 319. 263 Funk, Polizei und Rechtsstaat, S. 313 f. 264 Vgl. Funk, Polizei und Rechtsstaat, S. 314 f. 265 Brodeur, Gewalt und Polizei, S. 264. 266 Funk, Polizei und Rechtsstaat, S. 313. 3. Polizeisoziologische Grundlagen 67 sehr unterschiedlichen gesellschaftlichen Rollen der Polizei kompatibel sind und verschiedene Formen der Institutionalisierung der Polizei zulassen. Im weiteren Verlauf dieser Dissertation wird daher zu prüfen sein, inwiefern diese beiden Konzepte dazu beitragen können, die Funktion, Bedeutung und Wirkung der deutschen Polizei in der Zwischenkriegszeit zu erklären. Der dramaturgische Ansatz Der dramaturgische Ansatz der Polizeisoziologie wurde von Peter K. Manning in den 1970er Jahren entwickelt und ausführlich in seinem im Jahr 1977 erschienenen, sehr einflussreichen Werk mit dem Titel ‚Police Work‘ dargestellt.267 Im Gegensatz zu den bisher erörterten Ansätzen beschäftigt er sich weniger mit der Entstehung der Polizei und ihrer Funktion, sondern zielt insbesondere darauf ab, das Handeln der Polizei sowohl auf der individuellen wie auf der institutionellen Ebene zu erklären und die Ursachen für ihre Dysfunktionalitäten aufzudecken. Den Kerngedanken seines theoretischen Ansatzes fasst er sehr treffend folgendermaßen zusammen: „The police have trouble. […] They have been assigned the task of crime prevention, crime detection and the apprehension of criminals. Based on their legal monopoly of violence, they have staked out a mandate that claims to include the efficient, apolitical, and professional enforcement of the law. It is the contention of this article that the police have staked out a vast and unmanageable social domain. And what has happened as a result of their inability to accomplish their self-proclaimed mandate is that the police have resorted to the manipulation of appearances.”268 Etwas überspitzt formuliert, besagen die zentralen Thesen dieses Ansatzes dementsprechend, dass die Aufgaben der Polizei widersprüchlich und unerfüllbar sind und dass ein Großteil der Polizeiarbeit daher nur ‚Theater‘ bzw. ein ‚Schwindel‘ ist, da die Polizei die Öffentlichkeit über wesentliche d) 267 Vgl. Manning, Police Work. Vgl. auch die Rezension bei S. M. Wilz, J. Reichertz, Manning, Peter K. (1977): Police Work: The Social Organization of Policing, Cambridge: MIT Press, in: S. Kühl [Hrsg.], Schlüsselwerke der Organisationsforschung, Wiesbaden 2015, S. 431ff. 268 P. K. Manning, The police: mandate, strategies, and appearances, in: T. Newburn [Hrsg.], Policing: Key Readings, Cullompton 2005 (Erstveröffentlichung: 1978), S. 192 (Hervorhebung im Original). II. Theoretische Grundlagen 68 Inhalte, Ziele und Erfolge ihrer Tätigkeit täuscht.269 Dass dies nicht ohne Folgen für ihre Funktion als Instrument staatlicher Herrschaft bleiben kann, ist offensichtlich. Peter K. Mannings Analysen basieren im Wesentlichen auf den soziologischen Arbeiten von Erving Goffman, die kein einheitliches theoretisches Modell im Sinne einer ‚grand theory‘ darstellen, sondern eher ein vielschichtiges theoretisches Programm, das in der englischsprachigen Literatur insbesondere als ‚dramaturgical sociology‘ oder ‚frame analysis‘ bezeichnet wird.270 Im Mittelpunkt steht die Analyse von menschlichen Interaktionen, wobei Erving Goffman davon ausgeht, dass Menschen dabei stets versuchen, ein bestimmtes Bild von sich zu vermitteln, da sie sich bewusst sind, dass sie beobachtet werden, was im Ergebnis bedeutet, dass Menschen grundsätzlich immer ‚Theater spielen‘, d. h. in ihrem sozialen Umfeld wie Schauspieler agieren, die ihrem Publikum eine Rolle vorspielen und sich dabei dieser Rolle mehr oder weniger bewusst sind.271 Übertragen auf die Polizei als Organisation bedeutet dies, dass auch sie ein Theaterstück inszeniert, das im Wesentlichen darin besteht, dem Publikum vorzuspielen, dass „sie im Interesse der Bürger und Bürgerinnen eine effiziente, bürokratisch organisierte Macht ist, welche die Gesellschaft davor bewahrt, im Chaos zu versinken“272. Dieses Publikum umfasst eine Vielzahl an unterschiedlichen Akteuren, z. B. rechtschaffene Bürger, Kriminelle, Kollegen, die eigene Familie und Freunde, der unmittelbare Vorgesetzte, politische Entscheidungsträger, die Medien, usw., die durchaus sehr unterschiedliche Erwartungen in Bezug auf die Rolle der Polizei haben können.273 Dementsprechend müssen Polizeibeamte in Abhängigkeit von der jeweiligen Situation z. B. als gesetzestreuer und effizienter Ressourcenverwalter, als effektiver und entschlossener Kriminalitätsbekämpfer oder als engagierter und verständnisvoller ‚Freund und Helfer‘ auftreten. Der Umgang mit dieser Rollenambiguität stellt eine der zentralen Herausforderungen für die Polizei dar. Ursächlich hierfür ist nach Ansicht von Peter K. Manning vor allem eine falsche öffentliche Wahrnehmung der tatsächlichen Aufgaben der Polizei, 269 Vgl. Manning, The police, S. 194. 270 R. Hettlage, K. Lenz, Erving Goffman – Ein unbekannter Bekannter, in: R. Hettlage, K. Lenz [Hrsg.], Erving Goffman – Ein soziologischer Klassiker der 2. Generation? Stuttgart, Bern 1991, S.ff. 271 Vgl. E. Goffman, The Presentation of Self in Everyday Life, New York 1956, S. 22ff. und S. 70ff.; Manning, Police Work, S. 6ff. 272 Wilz, Reichertz, Manning, Peter K. (1977): Police Work, S. 434. 273 Vgl. Manning, The police, S. 193ff. 3. Polizeisoziologische Grundlagen 69 die sich nahezu ausschließlich auf einige wenige, sehr aufregende und gefährliche, auf die Verbrechensbekämpfung im engeren Sinne gerichtete Einsätze konzentriert und dabei außer Acht lässt, dass der weit überwiegende Teil der Polizeiarbeit ganz und gar nicht aufregend oder gefährlich ist.274 Das dabei gezeichnete, heroische Polizeibild ist zwar übertrieben und daher unzutreffend, es wird aber dennoch nicht von der Polizei korrigiert, sondern eher noch verstärkt, vor allem um das Vertrauen der Öffentlichkeit in die Leistungsfähigkeit der Polizei zu steigern und damit die Existenz dieser Institution zu legitimieren, was die öffentliche Wahrnehmung der Polizei und damit auch die Erwartungshaltung des Publikums weiter verfälscht. Hinzu kommen weitere widersprüchliche und ambivalente Anforderungen an die Polizei, die sich aus ihrem speziellen Aufgabenfeld ergeben und Polizeibeamte in ihrem beruflichen Alltag vor kaum lösbare Probleme und Dilemmata stellen, z. B. die Durchsetzung von Gesetzen, die von der Bevölkerung – und oftmals auch von Polizeibeamten – als unethisch, unmoralisch, ungerecht oder zumindest unnötig empfunden werden, die Lösung von Konflikten, bei denen die Schuldfrage kaum zu klären ist oder die beteiligten Konfliktparteien vermutlich beide eine Teilschuld tragen, oder die Funktion als Herrschaftsinstrument einer politischen Führung, die von einem Großteil der Bevölkerung abgelehnt wird.275 Im Ergebnis führen diese Schwierigkeiten und Widersprüche zu einem „impossible mandate“276, bei dessen Umsetzung die Polizei nur scheitern kann. Aus diesem Grund versucht sie erst gar nicht, dieses ‚Mandat‘ zu erfüllen. Stattdessen ergreift die Polizei – wie die meisten bürokratischen Organisationen und Berufsgruppen – Handlungsstrategien, die unter dem ‚Deckmantel‘ einer angeblichen Professionalisierung277 das Publikum manipulieren. Diese basieren im Wesentlichen darauf, lediglich den Eindruck zu erwecken, sich mit vollem Engagement der Erfüllung ihrer wichtigen und schwierigen Aufgaben zu widmen, und dabei nicht nur ihr Scheitern aktiv zu verschleiern, sondern zudem die altruistischen Werte ihrer Profession zu Gunsten der Ausweitung ihrer Macht und Autonomie sowie der 274 Vgl. Manning, The police, S. 196 f.; Manning, Police Work, S. 85ff. Vgl. auch Reiner, The Politics of the Police, S. 177ff. 275 Vgl. Manning, Police Work, S. 30ff. und S. 106ff.; Manning, The police, S. 197ff. 276 Manning, The police: mandate, strategies, and appearances, S. 196. 277 Vgl. J. B. L. Chan, Fair Cop – Learning the Art of Policing, Toronto u. a. 2003, S. 5ff. II. Theoretische Grundlagen 70 Sicherheit und des Prestiges ihrer Berufsangehörigen zu vernachlässigen.278 Zu den dabei angewandten Taktiken gehören die Berufung auf bürokratische Prozeduren, die über den hohen Grad an Ermessens- und Entscheidungsspielraum von Polizeibeamten in ihrem beruflichen Alltag hinwegtäuschen279, die Heranziehung von wenig aussagekräftigen, leicht manipulierbaren statistischen Kennzahlen – insbesondere Kriminalitäts-, Aufklärungs- oder Verhaftungsquoten – zur Messung des polizeilichen Erfolgs280, die Geheimhaltung von Informationen über erfolglose oder rechtswidrige Polizeieinsätze281, die Errichtung und Aufrechterhaltung einer ‚symbiotischen‘, teilweise sogar widerrechtlichen Beziehung mit den Staatsanwaltschaften und Gerichten, um die Dysfunktionalitäten des Strafverfolgungssystems zu verschleiern, und schließlich sogar die Kollaboration mit kriminellen Elementen, d. h. Korruption282. Die negativen gesellschaftlichen Konsequenzen solcher Strategien fasst Peter K. Manning folgendermaßen zusammen: „Thus, law enforcement becomes a self-justifying system. It becomes more responsive to its own needs than to serving society.”283 Wie bereits zuvor angemerkt wurde, gilt dies prinzipiell für die meisten Berufsgruppen und bürokratischen Organisationen, allerdings sind die negativen Folgen im Fall der Polizei aufgrund ihrer zentralen gesellschaftlichen Rolle und ihrer Befugnisse, physischen Zwang und Gewalt auszu- üben, besonders gravierend. 278 Vgl. Manning, Police Work, S. 119ff.; Manning, The police, S. 203ff. 279 Vgl. R. V. Ericson, The police as reproducers of order, in: T. Newburn [Hrsg.], Policing: Key Readings, Cullompton 2005 (Erstveröffentlichung: 1982), S. 222ff. 280 Vgl. B. Loveday, Managing crime: Police use of crime data as an indicator of effectiveness, in: International Journal of the Sociology of Law, 28. Jg. (2000), Nr. 3, S. 215ff. 281 Vgl. J. P. Crank, Understanding Police Culture, 2. Aufl., Cincinnati 2004, S. 276ff. 282 Vgl. J. Kleinig, Gratuities and corruption, in: T. Newburn [Hrsg.], Policing: Key Readings, Cullompton 2005 (Erstveröffentlichung: 1982), S. 596ff. 283 Manning, The police, S. 203. 3. Polizeisoziologische Grundlagen 71 Der organisationskulturelle Ansatz Der organisationskulturelle Ansatz betrachtet Organisationen als Sinn-Systeme mit spezifischen Überzeugungen, Werten und Symbolen.284 Dabei stammt der Kulturbegriff ursprünglich aus der Ethnologie und bezeichnet üblicherweise die speziellen, historisch entstandenen, zu einer komplexen Gesamtheit geronnenen Merkmale einer Volksgruppe.285 Eine so verstandene Kultur umfasst folglich implizite und explizite, tief verankerte Wert-, Denk- und Handlungsmuster, z. B. Sitten, Traditionen, Rituale, Umgangsformen, Symbole, Kunst, Moral, Religion, Recht, Wissen, usw., die über lange Zeiträume entstanden sind, das Denken, Fühlen und Handeln innerhalb einer Volksgruppe vereinheitlichen, und von den Gruppenmitgliedern gelernt, verinnerlicht, angewendet und an neue Mitglieder weitergegeben werden. Der organisationskulturelle Ansatz überträgt diesen Kulturbegriff nun auf Organisationen und geht dementsprechend davon aus, dass Organisationen – analog zu Volksgruppen – spezifische Vorstellungs- und Orientierungsmuster entwickeln, die einen starken und nachhaltigen Einfluss auf das Verhalten ihrer Mitglieder haben.286 Diese Muster entstehen im Laufe der historischen Entwicklung einer Organisation, so dass jede Organisation über eine eigene, einzigartige und unverwechselbare Organisationskultur verfügt. Eine Organisationskultur ist demzufolge ein System an kollektiven Annahmen, Überzeugungen, Gewohnheiten und Einstellungen, das die Wahrnehmung, das Denken und Fühlen sowie das Verhalten der Organisationsmitglieder prägt. Sie wird an neue Mitglieder weitergegeben und besteht insbesondere aus organisationalen Werten, Visionen, Normen, Praktiken und Symbolen.287 Die Organisationsmitglieder nehmen dies als kollektive Identität wahr, die ihrer Arbeit Sinn verleiht und einen starken e) 284 Zu den folgenden Ausführungen vgl. Vera, Organisation und Personalmanagement, S. 54ff.; Vera, Jablonowski, Organisationskultur der Polizei, S. 475ff.; A. Vera, K. Kölling, Street Cop Culture and the Aging Police Force: Understanding the Interplay between Demographic Change, Organizational Culture, Leadership and Police Officers’ Performance, in: European Journal of Policing Studies, 1. Jg. (2013), Nr. 1, S. 67ff. 285 Vgl. C. A. Schmitz, Kultur, Frankfurt a. M. 1963, S. 32. 286 Vgl. G. Schreyögg, Organisation – Grundlagen moderner Organisationsgestaltung, 3. Aufl., Wiesbaden 1999, S. 436ff.; S. A. Sackmann, Unternehmenskultur, Neuwied u. a. 2002, S. 24ff. 287 Vgl. Schreyögg, Organisation, S. 439ff.; Vera, Jablonowski, Organisationskultur der Polizei, S. 478 f. II. Theoretische Grundlagen 72 Einfluss auf die Arbeits- und Leistungsmotivation und damit auch auf die Leistungsfähigkeit der Organisation insgesamt hat.288 Selbstverständlich verfügt auch die Polizei über eine spezifische Organisationskultur. Diese gilt als „one of the strongest vocational subcultures existing in […] society“289 und sollte nicht als monolithische Einheit gesehen werden, da sie verschiedene Subkulturen enthält, die sich untereinander durchaus unterscheiden.290 So differenziert beispielsweise Peter K. Manning in Abhängigkeit der hierarchischen Ebene zwischen zwei polizeilichen Subkulturen, nämlich einer Kultur der ‚Senior Officers‘ und einer der ‚Police Constables‘.291 Rune Glomseth und Petter Gottschalk unterscheiden hingegen anhand der fachlichen Spezialisierung bzw. der Arbeitsteilung eine Streifenbeamtenkultur und eine kriminalpolizeilichen Kultur292, während Wendy Christensen und John P. Crank wiederum auf der Grundlage von geografischen Merkmalen zwischen einer urbanen und einer ländlichen Polizeikultur differenzieren293. Die am häufigsten verwendete Unterscheidung geht allerdings auf Elizabeth Reuss-Ianni und Francis A. J. Ianni zurück, die davon ausgehen, dass es in der Polizei mit der ‚Management Cop Culture‘ und der ‚Street Cop Culture‘ zwei zentrale Subkulturen gibt, die zwar eine unübersehbare hierarchische Dimension haben, die sich aber darüber hinaus insbesondere durch die sich darin widerspiegelnde Einstellung zu den Organisationszielen und der für ihre Erreichung einsetzbaren Mittel unterscheiden.294 Im deutschsprachigen Raum ist dies- 288 Vgl. Schein, Organizational Culture and Leadership, S. 3ff.; D. Ravasi, M. Schultz, Responding to Organizational Identity Threats: Exploring the Role of Organizational Culture, in: Academy of Management Journal, 49. Jg. (2006), Nr. 3, S. 433ff. 289 Thibault, Lynch, McBride, Proactive Police Management, S. 17. 290 Vgl. Reiner, The Politics of the Police, S. 116; J. B. L. Chan, Changing Police Culture, in: British Journal of Criminology, 36. Jg. (1996), Nr. 1, S. 111; L. Westmarland, Police cultures, in: T. Newburn, Handbook of Policing, 2. Aufl., Cullompton, Portland 2008, S. 254ff. 291 Vgl. Manning, Police Work, S. 134ff. 292 Vgl. R. Glomseth, P. Gottschalk, Occupational Culture as Determinant of Criminal Investigation Performance: An Empirical Study of Norwegian Police as Value Shop, in: International Journal of Management Practice, 2. Jg. (2007), Nr. 4, S. 269ff. 293 Vgl. W. Christensen, J. P. Crank, Police Work and Culture in a Nonurban Setting: An Ethnographic Analysis, in: Police Quarterly, 4. Jg. (2001), Nr. 1, S. 69ff. 294 Vgl. E. Reuss-Ianni, F. A. J. Ianni, Street cops and managing cops: the two cultures of policing, in: T. Newburn [Hrsg.], Policing: Key Readings, Cullompton 2005 (Erstveröffentlichung: 1983), S. 297ff. 3. Polizeisoziologische Grundlagen 73 bezüglich das von Rafael Behr geprägte Begriffspaar ‚Polizeikultur‘ und ‚Polizistenkultur‘ sehr verbreitet.295 Die Management Cop Culture bzw. Polizeikultur ist typisch für die oberen Hierarchieebenen der Polizei, die nicht nur darauf achten müssen, dass die Organisationsziele erreicht werden, sondern darüber hinaus auch die Angemessenheit und Verhältnismäßigkeit der dabei eingesetzten Mittel, d. h. die Effizienz des Ressourceneinsatzes und die Legalität der polizeilichen Maßnahmen, kontrollieren müssen. Dementsprechend entspricht diese Subkultur der ‚offiziellen‘ Organisationskultur, die stets mit den politischen, rechtlichen und bürokratischen Vorgaben in Einklang steht, d. h. „doing the right thing according to the rules“296. Die Street Cop Culture bzw. Polizistenkultur ist wiederum charakteristisch für die unteren Hierarchieebenen der Polizei und insbesondere für die Streifenbeamten, die ihren Dienst ‚auf der Straße‘ erbringen und vor allem an der Erreichung der polizeilich-operativen Organisationsziele interessiert sind, z. B. an der Festnahme eines Verdächtigen oder der Auflösung einer Demonstration, während die dabei eingesetzten Mittel keine zentrale Rolle spielen.297 Dementsprechend orientiert sich diese Subkultur weniger an den offiziellen, formalen Regeln, sondern vielmehr an informellen Regeln, die ihren Ursprung in den praktischen Erfahrungen von Polizeibeamten haben. Dabei entwickeln sich im Laufe der Zeit diejenigen Regeln und Verhaltensweise, die sich bei der Bewältigung des polizeilichen Arbeitsalltags als besonders erfolgreich bewährt haben, zu kulturellen Normen, auch wenn diese nicht mit den bürokratischen, teilweise sogar nicht einmal mit den rechtlichen Vorgaben in Einklang stehen.298 In diesem Zusammenhang ist allerdings zu beachten, dass diese Unterteilung in Management und Street Cop Culture theoretischer Natur ist und analytischen Zwecken dient, wohingegen diese beiden Subkulturen in der polizeilichen Praxis untrennbar miteinander verbunden sind. Sowohl polizeiliche Führungskräfte als auch Kriminal- und Streifenbeamte werden – wenn auch in unterschiedlichem Ausmaß – von beiden Subkulturen geprägt, so dass formale und informelle Regeln, Polizeikultur und Polizistenkultur das Handeln der Polizei über alle Ebenen hinweg beeinflussen. Gleichwohl scheint die Street Cop Cul- 295 Vgl. R. Behr, Cop Culture – Der Alltag des Gewaltmonopols, Opladen 2000, S. 227ff. 296 R. R. Roberg, J. Kuykendall, Police Management, Los Angeles 1997, S. 104. 297 Vgl. Vera, Jablonowski, Organisationskultur der Polizei, S. 485 f. 298 Vgl. J. P. Crank, M. A. Caldero, Police Ethics: The Corruption of Noble Cause, 3. Aufl., New Providence 2011, S. 201ff. II. Theoretische Grundlagen 74 ture dabei eine dominante Rolle zu spielen, so dass Robert Reiner sie als „the core police culture“299 bezeichnet. Dabei liegen die Wurzeln der Street Cop Culture in ihrer Geschichte als militärische bzw. paramilitärische Organisation mit autoritativer Prägung, die hierarchische Entscheidungsstrukturen pflegt und von ihren Angehörigen Gehorsam und Konformität erwartet.300 Sie basiert vor allem auf den praktischen Erfahrungen von Polizeibeamten im Streifendienst ‚auf der Straße‘, der in kleinen Teams, in der Regel zu zweit, weitgehend isoliert von anderen Organisationsmitgliedern geleistet wird, so dass die relevanten informellen Normen und Werte von der dabei zwar nicht permanent, aber durchaus regelmäßig erlebten Gewalt und den Gefahren für die eigene Person geprägt werden. Dementsprechend zeichnet sich die kulturelle Identität von Polizeibeamten insbesondere durch Faktoren wie Stärke, Kraft, Zwang, Aggressivität, Gefahr, Angst, Unsicherheit und moralische Ambiguität aus. Von zentraler Bedeutung ist dabei ein Männlichkeitskult, der den Einsatz von Zwang und Gewalt gegen Kriminelle und Störer als moralisch, gerecht und heroisch ‚zelebriert‘.301 Weitere kulturelle Normen sind Verschwiegenheit, soziale Isolation und Solidarität, wobei gerade der letztgenannte Aspekt von überragender Bedeutung für die berufliche Iden- 299 Vgl. Reiner, The Politics of the Police, S. 118. Vgl. auch Roberg, Kuykendall, Police Management, S. 105. 300 Vgl. D. Ivie, B. Garland, Stress and Burnout in Policing: Does Military Experience Matter? in: Policing: An International Journal of Police Strategies & Management, 34. Jg. (2011), Nr. 1, S. 49ff.; M. Clark, The Importance of a New Philosophy to the Postmodern Policing Environment, in: Policing: An International Journal of Police Strategies & Management, 28. Jg. (2005), Nr. 4, S. 642ff.; J. F. Hodgson, Police Violence in Canada and the USA: Analysis and Management, in: Policing: An International Journal of Police Strategies & Management, 24. Jg. (2001), Nr. 4, S. 520ff.; Vera, Kölling, Street Cop Culture and the Aging Police Force, S. 68; F. Barth-Farkas, A. Vera, Power and Transformational Leadership in Public Organizations, in: International Journal of Leadership in Public Services, 10. Jg. (2014), Nr. 4, S. 224; F. Barth-Farkas, A. Vera, Transformational, transactional and cooperative police leadership in theory and practice, in: European Police Science and Research Bulletin, o. Jg. (2016), Nr. 14, S. 36. 301 Vgl. Chan, Fair Cop, S. 201ff.; F. Cullen, B. Link, L. Travis, T. Lemming, Paradox in Policing: A Note on Perceptions of Danger, in: A. Blumberg, E. Niederhoffer [Hrsg.], The Ambivalent Force: Perspectives on the Police, New York 1983, S. 351ff.; P. Dick, Dirty Work Designations: How Police Officers Account for their Use of Coercive Authority, in: Human Relations, 58. Jg. (2005), Nr. 11, S. 1363ff; P. A. J. Waddington, Police (Canteen) Subculture: An Appreciation, in: British Journal of Criminology, 39. Jg. (1999), Nr. 2, S. 287ff.; Manning, Police Work, S. 148ff. und S. 259ff. 3. Polizeisoziologische Grundlagen 75 tität und das Selbstverständnis von Polizeibeamten ist, die die Polizei als ihre ‚Familie‘ betrachten, ihren Kollegen bedingungslos vertrauen und von diesen in einem – wie auch immer gearteten – Notfall uneingeschränkte Unterstützung erwarten können302: „One of the most profound statements that any police officer can make is that he or she is never alone once having become a sworn officer. On the job, the call for ‚officer in trouble‘ will mean that officers in and outside the immediate vicinity will normally drop what they are doing and rush to that officer’s help. And officers off duty will feel compelled to come to that officer’s aid, even from a distance.“303 In der Praxis führt diese grundsätzlich als positiv zu wertende Solidarität und Kollegialität zwischen Polizeibeamten allerdings in Verbindung mit einigen weiteren, für den Polizeiberuf charakteristischen Faktoren wie sozialer Isolation, Verschwiegenheit sowie eingeschränkten externen Kontrollmöglichkeiten nicht selten zu unerwünschten oder sogar illegalen Praktiken wie der unnötigen Anwendung von Gewalt oder Korruption.304 Außerdem wird Street Cop Culture in verschiedenen Studien mit negativen und unerwünschten Persönlichkeitsmerkmalen und Phänomenen wie z. B. Zynismus, Gleichgültigkeit, Brutalität, Feindseligkeit, Entfremdung, Machismus, Sexismus und Rassismus in Verbindung gebracht und dementsprechend als „white, male organizational culture“305 charakterisiert.306 302 Vgl. J. M. Cancino, R. Enriquez, A Qualitative Analysis of Officer Peer Retaliation – Preserving the Police Culture, in: Policing: An International Journal of Police Strategies & Management, 27. Jg. (2004), Nr. 3, S. 320ff.; Thibault, Lynch, McBride, Proactive Police Management, S. 18 f.; Crank, Understanding Police Culture, S. 237ff. 303 Thibault, Lynch, McBride, Proactive Police Management, S. 22. 304 Vgl. Chan, Fair Cop, S. 229ff.; Thibault, Lynch, McBride, Proactive Police Management, S. 29ff. 305 C. Heijes, Officers at Work in a Multicultural Police Force, in: Policing: An International Journal of Police Strategies & Management, 30. Jg. (2007), Nr. 4, S. 551. 306 Vgl. B. N. Carpenter, S. M. Raza, Personality Characteristics of Police Applicants: Comparisons across Subgroups and with Other Populations, in: Journal of Police Science and Administration, 15. Jg. (1987), Nr. 1, S. 10ff.; R. M. Regoli, J. Crank, R. Culbertson, Police Cynicism, Job Satisfaction, and Work Relations among Police Chiefs: An Assessment of Department Size, in: Sociological Focus, 22. Jg. (1989), Nr. 3, S. 161ff.; Hodgson, Police Violence, S. 520ff.; Reiner, The Politics of the Police, S. 128ff.; F. Barth-Farkas, A. Vera, Female Leaders in a Male Organisation: An Empirical Analysis of Leader Prototypicality, II. Theoretische Grundlagen 76 Die eben beschriebene Organisationskultur der Polizei lässt sich erstaunlicherweise in sehr ähnlicher Form in fast allen Industrienationen nachweisen. So stellen Jerome H. Skolnick und James J. Fyfe fest, dass die „fundamental culture of policing is everywhere similar [… since] the same features of the police role – danger, authority, and the mandate to use coercive force – are everywhere present“307. Dabei haben nationale Kulturen durchaus Auswirkungen auf die jeweiligen Polizeien und die dominanten Verhaltensmuster von Polizeibeamten. Allerdings betrifft dies weniger die organisationskulturelle Ebene, deren zentralen Merkmale „are rooted in constant problems that officers face in carrying out the role they are mandated to perform, at any rate in industrial capitalist societies with a liberal-democratic political ethos“308. Dies gilt grundsätzlich auch für die geschichtliche Dimension, so dass es nicht verwundert, dass die Organisationskultur der Polizei und die damit verbundenen Einstellungs-, Orientierungs- und Verhaltensmuster der Polizeibeamten in den meisten westlichen Industriestaaten im Laufe der letzten Jahrzehnte trotz der fortwährenden Veränderungen der politischen und gesellschaftlichen Rahmenbedingungen bemerkenswert stabil geblieben sind.309 Für die in der vorliegenden Dissertation betrachtete deutsche Zwischenkriegszeit ist die Annahme einer solchen Stabilität der Organisationskultur der Polizei angesichts der in diefsem Zeitraum in Deutschland stattfindenden, durchaus drastischen Veränderungen der Regierungs- und Herrschaftsformen von der Monarchie im Wilhelminischen Kaiserreich zur demokratischen Grundordnung der Weimarer Republik und dann zur nationalsozialistischen Diktatur aber zweifelhaft. Dementsprechend erscheint die Berücksichtigung von organisationskulturellen Merkmalen im Rahmen einer kulturhistorischen Analyse der deutschen Polizei in der Zwischenkriegszeit gut geeignet, um ihre Rolle als Instrument staatlicher Herrschaft zu verstehen und zu erklären. Power and Gender in the German Police, in: European Law Enforcement Research Bulletin, o. Jg. (2018), Nr. 17, S. 51ff. 307 Vgl. J. H. Skolnick, J. J. Fyfe, Above the Law: Police and the Excessive Use of Force, New York 1993, S. 92. 308 Reiner, The Politics of the Police, S. 118. 309 Vgl. J. H. Skolnick, Enduring issues of police culture and demographics, in: Policing and Society: An International Journal of Research and Policy, 18. Jg. (2008), Nr. 1, S. 35ff.; B. Loftus, Police occupational culture: classic themes, altered times, in: Policing and Society: An International Journal of Research and Policy, 20. Jg. (2010), Nr. 1, S. 1ff. 3. Polizeisoziologische Grundlagen 77 Historische Grundlagen Die theoretischen Ausführungen im vorhergehenden Kapitel haben verdeutlicht, dass staatliche Herrschaft ein vielschichtiges und komplexes Konstrukt ist, das zahlreiche gesellschaftliche Macht- und Interessenkonstellationen umfasst, in die die Polizei als zentraler Träger des staatlichen Gewaltmonopols im Innern eingebettet ist. Die betrachteten polizei- und herrschaftssoziologischen Ansätze haben dabei eine ganze Reihe von Aspekten aufgedeckt, die bei der Analyse der gesellschaftlichen Rolle der Polizei in der deutschen Zwischenkriegszeit von Bedeutung sein dürften. Im weiteren Verlauf dieser Arbeit sollen daher diese eben dargestellten Erkenntnisse auf einen bestimmten historischen Kontext – nämlich die Polizei der deutschen Zwischenkriegszeit – übertragen werden. Dieser historische Kontext wird nun im Folgenden in groben Zügen dargestellt. Dabei wird zunächst (1) die geschichtliche Entwicklung der Polizei beginnend mit ihren Anfängen im Altertum bis zum Beginn der hier betrachteten Zwischenkriegszeit dargestellt, anschließend (2) die Geschichte der deutschen Zwischenkriegszeit, d. h. der am 9. November 1918 ausgerufenen Weimarer Republik und der nationalsozialistischen Diktatur bis zum Ausbruch des Zweiten Weltkriegs am 1. September 1939, behandelt, wobei der Schwerpunkt der Betrachtung auf sicherheitsrelevante Aspekte gelegt wird, und schließlich auf (3) die Entwicklung der Kriminalität im Deutschland der Zwischenkriegszeit eingegangen. Verzichtet wird in diesem dritten Kapitel auf eine Darstellung der geschichtlichen Entwicklung der deutschen Polizei in der Zwischenkriegszeit, da dies Gegenstand des vierten Kapitels sein wird. Geschichte der Polizei Die Beantwortung der Frage nach dem historischen Ursprung der Polizei ist untrennbar mit der gewählten Abgrenzung des Polizeibegriffs verknüpft. Geht man von einem modernen Polizeibegriff aus, der die Polizei primär als Instrument staatlicher Herrschaft bzw. als „eigenständige[n], professionelle[n], über das gesamte Territorium verteilte[n], quantitativ bedeutsame[n] und die staatliche und gesellschaftliche Ordnung umfassend III. 1. 78 garantierende[n] Institution“310 betrachtet, dann muss man der in der Literatur sehr weit verbreiteten Ansicht zustimmen, dass die Polizei erst im Laufe des 19. Jahrhunderts parallel zur Entstehung moderner Staatlichkeit entstanden ist.311 Die davor liegende Zeit wäre dann aus polizeihistorischer Sicht „merely a defective prologue to the modern police“312, in der die polizeilichen Funktionen zwar mehr oder weniger gut wahrgenommen wurden, allerdings nicht von der Polizei. Robert Reiner stellt hierzu fest: „Until modern times, policing functions were carried out primarily as a by-product of other social relationships and by citizen ‚volunteers‘ or private employees. […] Specialized policing institutions emerge only in relatively complex societies […]. They are means for the emergence and protection of more centralized and dominant class and state systems.“313 Eine solche Übertragung einer modernen Begrifflichkeit auf vormoderne Verhältnisse ist aber nicht unproblematisch, da dies das Risiko birgt, dass auf diese Weise auch neuzeitliche Erfahrungen und Annahmen unzulässigerweise auf die früheren Verhältnisse übertragen und die Besonderheiten der betrachteten Epochen sowie die ihnen zu Grunde liegenden Rationalitäten vernachlässigt werden.314 Zudem kann die Auseinandersetzung mit früheren, andersartigen Polizeikonzepten und -vorstellungen die wissenschaftliche Auseinandersetzung mit dem modernen Verständnis der Polizei bereichern.315 Insofern soll für die folgende kurze Darstellung der geschichtlichen Entwicklung der Polizei eine weitere Begriffsabgrenzung gewählt werden, die auch Vorstufen der modernen Polizei bzw. „funktiona- 310 Funk, Polizei und Rechtsstaat, S. 314. 311 Leßmann-Faust, Geschichte der Polizei, S. 10; Funk, Polizei und Rechtsstaat, S. 13ff.; Vogl, State Desire, S. 68; Härter, Polizei, Sp. 170 und Sp. 179; Funk, Die Entstehung der modernen Polizei, S. 56ff.; Scheerer, Herrnkind, Mehr Sicherheit vor Polizeigewalt, S. V.; Newburn, Introduction, S. 1; Mawby, Models of policing, S. 19; Emsley, The birth and development of the police, S. 72; Knöbl, Polizei und Herrschaft, S. 28 f. 312 Rawlings, Policing before the police, S. 47. 313 Reiner, The Politics of the Police, S. 6,. 314 Vgl. W. Nippel, Aufruhr und ‚Polizei‘ in der Römischen Republik, Stuttgart 1988, S. 7. 315 Vgl. T. Zischke, Liktoren: Polizei im alten Rom? in: J. Grutzpalk, A. Bruhn, J. Fatianova, F. Harnisch, C. Mochan, B. Schülzke, T. Zischke [Hrsg.], Beiträge zu einer vergleichenden Soziologie der Polizei, Potsdam 2009, S. 56 f.; H. Lisken, E. Denninger, Römische Rechtsgeschichte, Köln 2001, S. 2. 1. Geschichte der Polizei 79 le[n] Äquivalente[n] für die ‚Polizei vor der Polizei‘“316 umfasst. Hierfür bietet sich die folgende pragmatische, für genau diesen Zweck entwickelte Begriffsabgrenzung von Philip Rawlings an: „By policing is meant the maintenance of order, the control of disorder, the prevention of crime and the detection of offenders, and by the police is meant those officials concerned with policing matters.“317 Legt man ein solches Polizeiverständnis zu Grunde, dann lassen sich polizeiähnliche Institutionen spätestens seit der Entwicklung der ersten Hochkulturen weltweit nachweisen. Dementsprechend kann im Rahmen der vorliegenden Arbeit aus offensichtlichen Gründen kein auch nur annähernd vollständiger Überblick über die geschichtliche Entwicklung der Polizei gegeben werden. Vielmehr sollen im Folgenden nur punktuell einige wichtige Epochen und Regionen herausgegriffen werden, um beispielhaft zu beschreiben, wie sich die Polizei bzw. die polizeiliche Aufgabenerledigung im Laufe der Jahrtausende entwickelt hat, wobei angesichts der Themas dieser Arbeit der Schwerpunkt bewusst auf Europa und ab dem Mittelalter auf Deutschland gelegt wird. Das Altertum Eine wesentliche Schwierigkeit bei der geschichtswissenschaftlichen Auseinandersetzung mit der Polizei in vormodernen Epochen liegt darin, dass man diese Institution nicht trennscharf vom Militär abgrenzen kann, das ja bis weit in die Moderne hinein in unterschiedlichem Ausmaß ordnungssichernde Aufgaben im Inneren übernahm.318 Dies galt beispielsweise für das Alte Ägypten, das üblicherweise auf den Zeitraum zwischen dem 4. Jahrtausend v. Chr. und dem Tod der letzten ptolemäischen Königin, Kleopatra VII., im Jahr 30 v. Chr. datiert wird.319 Hier setzten die für die öffentliche Ordnung und Sicherheit zuständigen Nomarchen bzw. Gaufürsten zwar die vor Ort stationierten Teile des Heeres für die Aufrechterhaltung der öffentlichen Ordnung ein, im Laufe der Zeit – ab etwa 1600 v. Chr. – spezialisierten sich dann allerdings die dem nubischen Stamm der Medjay a) 316 Nippel, Aufruhr und ‚Polizei‘ in der Römischen Republik, S. 9. 317 Rawlings, Policing before the police, S. 47. 318 Vgl. Knöbl, Polizei und Herrschaft, S. 66ff. 319 Vgl. z. B. S. Kubisch, Das Alte Ägypten: Von 4000 v. Chr. bis 30 v. Chr., Wiesbaden 2017. III. Historische Grundlagen 80 bzw. Mezai angehörenden Söldner auf Aufgaben der inneren Sicherheit.320 Dabei entstand eine mit Speeren, Schilden und Bögen bewaffnete, uniformierte, einem zivilen ägyptischen Beamten unterstellte Truppe, die in allen größeren Siedlungen und Distrikten stationiert war. Diese sorgte flächendeckend für Sicherheit und Ordnung und übte dabei insbesondere Streifen- und Wachdienste aus, so dass Patrick B. Adamson von einer „civilian police force“321 und Roger S. Bagnall von „professional police forces“322 sprechen. Eine ähnliche Funktion kam in dieser Epoche den Itua in Assyrien zu.323 Nach der Eroberung Ägyptens durch Alexander den Großen im Jahr 332 v. Chr. wurde diese Truppe dann aufgelöst und durch die ähnlich strukturierten Phylakitai ersetzt – eine hauptsächlich aus Ägyptern bestehende, aber von einem griechischem Kommandanten geführte, bewaffnete, uniformierte Truppe, die Roger S. Bagnalls Einschätzung zufolge aus „professionals, career police, with a regular position and regular pay“ bestand.324 Im Zusammenspiel mit einer relativ weit entwickelten Justiz führt dies zu einem Strafjustizsystem „which was far ahead of its time“325. Nach der Einnahme Ägyptens durch römische Truppen ab 30 v. Chr. wurden die Phylakitai dann durch die neuen Machthaber rasch aufgelöst. Die Zuständigkeit für die polizeilichen Belange wurde ehemaligen römischen Militärführern als Ehrenamt – d. h. nicht vergütet – übertragen, die bei Bedarf auf reguläre Militäreinheiten zurückgreifen konnten.326 Zudem kamen ägyptische ‚Phylakes‘ und ‚Ephodoi‘ zum Einsatz, die aber nur sehr eingeschränkt polizeiliche Funktionen ausübten und nach heutigem Sprachgebrauch wohl eher als Wachen und Personenschützer bezeichnet werden müssten.327 Im 320 Vgl. P. Riege, Kleine Polizei-Geschichte, 3. Aufl., Lübeck 1966, S. 9 f.; P. B. Adamson, Some Comments on the Origin of the Police, in: Police Studies: International Review of Police Development, 14. Jg. (1991), Nr. 1, S. 1. 321 Adamson, Some Comments on the Origin of the Police, S. 1. 322 R. S. Bagnall, Army and Police in Roman Upper Egypt, in: Journal of the American Research Center in Egypt, 14. Jg. (1977), Nr. 1, S. 67. 323 Vgl. Adamson, Some Comments on the Origin of the Police, S. 1 f. 324 Vgl. Bagnall, Army and Police in Roman Upper Egypt, S. 67ff. (Zitat: S. 67); J. Bauschatz, Law and Enforcement in Ptolemaic Egypt, Cambridge 2013, S. 49ff. 325 A. J. van Loon, Law and Order in Ancient Egypt: The Development of Criminal Justice from the Pharaonic New Kingdom until the Roman Dominate, Leiden 2014, S. 56, http://hdl.handle.net/1887/30196 (Zugriff: 12.2.2018.). 326 Vgl. van Loon, Law and Order in Ancient Egypt, S. 50 f. 327 Vgl. Bauschatz, Law and Enforcement in Ptolemaic Egypt, S. 133ff. und S. 148ff.; Bagnall, Army and Police in Roman Upper Egypt, S. 67 f. 1. Geschichte der Polizei 81 Ergebnis führte dies zu einem „steep decline in the quality and effectiveness of criminal justice in Roman Egypt“328. Die Fortschrittlichkeit des ägyptischen Polizeiwesens wird insbesondere dann deutlich, wenn man das antike Griechenland, das üblicherweise die archaische und klassische Zeit und damit den Zeitraum zwischen dem 8. Jahrhundert v. Chr. und der Mitte des 2. Jahrhunderts v. Chr. umfasst329, als Vergleich heranzieht. Hier zeigt sich nämlich recht deutlich, dass dieses wesentlich weniger entwickelt war. Zwar kamen anlassbezogen bei der Aufrechterhaltung der öffentlichen Ordnung – beispielsweise der Sicherung von öffentlichen Versammlungen, Gefangenentransporten oder Hinrichtungen – neben dem Militär auch Sklaven, die sich im öffentlichen Besitz befanden, insbesondere die in der Literatur oft erwähnte, mit Bögen bewaffnete ‚Skythische Truppe‘, zum Einsatz.330 Allerdings handelt es sich hier um eine sehr eingeschränkte polizeiliche Funktion, so dass die Verwendung des Polizeibegriffs unzulässig erscheint.331 Dies gilt erst recht für die spartanische Krypteia, die man entweder als militärisches Abhärtungstraining oder als Terrorinstrument gegenüber den Heloten betrachten kann332, deren Charakterisierung als ‚Polizeieinrichtung‘ bei Paul Riege aber ziemlich abwegig erscheint.333 Selbst in Athen als fortschrittlichster Metropole des antiken Griechenlands gab es keinen polizeilichen Streifendienst und blieb insbesondere die Ermittlung, Fahndung und Festnahme von potenziellen Straftätern weitgehend eine private Angelegenheit der betroffenen Bürger, in die sich nur in seltenen Fällen staatliche Akteure einmischten.334 Dementsprechend scheint insgesamt – auch bei einer weiten Auslegung des Polizeibegriffs – Jens-Uwe Krauses Einschätzung, dass „Athen […] keine Polizei [kannte]“335, durchaus zutreffend zu sein. Allerdings sollte dies nicht als gravierendes Defizit oder als Ursache für ein geringes Maß an öffentlicher Sicher- 328 van Loon, Law and Order in Ancient Egypt, S. 56. 329 Vgl. z. B. M. Sehlmeyer, Die Antike, 2. Aufl., Paderborn u. a. 2014, S. 10 f. 330 Vgl. Riege, Kleine Polizei-Geschichte, S. 10; M. Roth, Crime and Punishment: A History of the Criminal Justice System, 2. Aufl., Wadsworth 2010, S. 13. 331 Vgl. J.-U. Krause, Kriminalgeschichte der Antike, München 2004, S. 13. 332 Vgl. B. D. Ross, Krypteia: A Form of Ancient Guerrilla Warfare, in: Grand Valley Journal of History: 1. Jg. (2012), Nr. 2, S. 1ff., http://scholarworks.gvsu.edu/gvjh/ vol1/iss2/4 (Zugriff: 12.2.2018). 333 Vgl. Riege, Kleine Polizei-Geschichte, S. 10. 334 Vgl. V. J. Hunter, Policing Athens: Social Control in the Attic Lawsuits, 420-320 B. C., Princeton 1994, S. 3; Krause, Kriminalgeschichte der Antike, S. 14 f. 335 Krause, Kriminalgeschichte der Antike, S. 13. III. Historische Grundlagen 82 heit interpretiert werden, für das sich in der Literatur keine Hinweise finden.336 Angesichts der geringen Bevölkerungsdichte im antiken Griechenland und der geringen Größe der Städte erscheint es durchaus plausibel, dass die öffentliche Sicherheit auch ohne eine institutionalisierte, professionelle Polizei effektiv gewährleistet werden konnte. Dies gilt im Prinzip auch für das antike Rom und insbesondere für die Zeit der Republik ab etwa dem 5. Jahrhundert v. Chr. bis 27 v. Chr.337 Zwar gab es mit den Magistraten eine Institution, die für die Durchsetzung der öffentlichen Ordnung zuständig war und der damit eine polizeiähnliche Funktion zukam, allerdings verfügten sie weder über einen entsprechenden Personalkörper noch sahen sie die Kriminalitätsbekämpfung als zentrales Aufgabenfeld an.338 Oft werden in der Literatur das von den Magistraten beschäftigte und aus der Staatskasse besoldete Hilfspersonal – die Apparitores – und hier vor allem die Liktoren als Polizeiexekutivbeamte bezeichnet339, was aber angesichts ihrer geringen Anzahl (in der Regel ca. 24), der nur leichten und eher symbolischen Bewaffnung mit einem Fascis – einem von Birken- und Ulmenruten umgebenen Beil – und ihrer sakral geprägten Rolle als ständige Begleiter des Magistrats zweifelhaft erscheint.340 Die Liktoren führten zwar im Auftrag ihrer Magistrate Festnahmen, Verhaftungen, Bestrafungen und sogar Hinrichtungen durch, allerdings geschah dies relativ selten und beruhte „in hohem Maße darauf, daß der Gehorsam gegenüber den Trägern der Insignien der magistratischen Gewalt vorausgesetzt“341 und damit ohne Zwangsmaßnahmen gewährleistet werden konnte. Ein Liktor war dementsprechend wohl weniger ein Herrschaftsinstrument zur Ausübung von Macht und vielmehr „ein Zeichen der Macht“342. Und auch in Bezug auf die für die Ordnung in der Stadt, die Getreideversorgung und die öffentlichen Spiele zuständigen und daher in der Literatur teilweise als Polizisten bezeichneten Aedilen343 muss 336 Vgl. Krause, Kriminalgeschichte der Antike, S. 24ff. 337 Vgl. z. B. Sehlmeyer, Die Antike, S. 117 f. 338 Vgl. Nippel, Aufruhr und ‚Polizei‘ in der Römischen Republik, S. 11ff. 339 Vgl. Riege, Kleine Polizei-Geschichte, S. 11; R. Harnischmacher, A. Semerak, Deutsche Polizeigeschichte, Stuttgart u. a. 1986, S. 2, Zischke, Liktoren: Polizei im alten Rom, S. 67 f. 340 Vgl. Nippel, Aufruhr und ‚Polizei‘ in der Römischen Republik, S. 20ff.; Zischke, Liktoren: Polizei im alten Rom, S. 63ff. 341 Nippel, Aufruhr und ‚Polizei‘ in der Römischen Republik, S. 20. 342 Zischke, Liktoren: Polizei im alten Rom, S. 65. 343 Vgl. Riege, Kleine Polizei-Geschichte, S. 11 f.; Harnischmacher, Semerak, Deutsche Polizeigeschichte, S. 2. 1. Geschichte der Polizei 83 man bei genauerer Betrachtung und angesichts ihrer sehr eingeschränkten Durchsetzungsfähigkeit zu dem Ergebnis kommen, dass es „kaum Anzeichen dafür [gibt], daß den Aedilen eine allgemeine Polizeifunktion im engeren Sinne des Schutzes des öffentlichen Friedens oder gar der Gefahrenabwehr für die Bürger zugekommen wäre“344. Insofern bleibt festzuhalten, dass in der Römischen Republik die Aufrechterhaltung der öffentlichen Ordnung hauptsächlich durch das Heer erfolgte, das allerdings nicht innerhalb der römischen Stadtgrenze eingesetzt werden durfte345, während die Kriminalitätsbekämpfung – wie im antiken Griechenland – weitgehend eine private Angelegenheit der betroffenen Bürger blieb. Dies änderte sich allerdings in der Römischen Kaiserzeit ab 27 v. Chr.346, für die Christopher J. Fuhrmann feststellt, „that the self-help model often fails to fit the imperial-era evidence and that state-policing significantly expanded in the first three centuries AD. […] The expansion of policing occurred as a result of the accretion of the state’s ad hoc responses to security needs in Rome, Italy, and the provinces.”347 Diese Entwicklung betraf insbesondere die Hauptstadt Rom, wo bereits der erste Kaiser, Augustus, mit der republikanischen Tradition brach und militärische Truppen im Stadtgebiet stationierte.348 Die unter Augustus dort stationierten und ihm oder seinem unmittelbaren Umfeld direkt unterstellten neun Kohorten Praetorianer (‚cohortes praetoriae‘) sowie die drei Stadtkohorten (‚cohortes urbanae‘) führten mit ihrer Personalstärke von mehr als 5.000 Mann zu einer massiven und permanenten militärischen Präsenz im römischen Stadtgebiet, die unter den nachfolgenden Kaisern nicht nur beibehalten, sondern sogar noch ausgebaut wurde.349 Die Hauptfunktion dieser Truppen war allgemein die Kontrolle der Hauptstadt, so dass sie u. a. zur Unterdrückung von Aufständen, zur Überwachung der öffentlichen Spiele, als Wachposten, bei Verhaftungen und Exe- 344 Nippel, Aufruhr und ‚Polizei‘ in der Römischen Republik, S. 33. 345 Vgl. Nippel, Aufruhr und ‚Polizei‘ in der Römischen Republik, S. 11 f. 346 Vgl. z. B. Sehlmeyer, Die Antike, S. 152. 347 C. J. Fuhrmann, Policing the Roman Empire: Soldiers, Administration, and Public Order, Oxford 2012, S. 8. Vgl. auch Riege, Kleine Polizei-Geschichte, S. 12; Harnischmacher, Semerak, Deutsche Polizeigeschichte, S. 2 f. 348 Vgl. Fuhrmann, Policing the Roman Empire, S. 89ff. 349 Vgl. Krause, Kriminalgeschichte der Antike, S. 44ff.; Nippel, Aufruhr und ‚Polizei‘ in der Römischen Republik, S. 161 f. Fuhrmann, Policing the Roman Empire, S. 123ff. III. Historische Grundlagen 84 kutionen, aber auch für Kurier- und Spitzeldienste sowie gelegentlich auch für Mordanschläge eingesetzt wurden.350 Hinzu kamen ab 6 n. Chr. die ‚Vigiles‘, eine ca. 7.000 Mann starke, paramilitärisch organisierte Feuerschutztruppe, die nächtliche Patrouillen durchführte und dabei neben der Einhaltung der Feuerschutzbestimmungen wohl auch gelegentlich Kleinkriminelle festnahm.351 Im Ergebnis lässt sich folglich festhalten, dass es in der Römischen Kaiserzeit zumindest im römischen Stadtgebiet mehrere Institutionen gab, die in erheblichem Umfang militärisch geschultes, bewaffnetes Personal beschäftigten, für die Aufrechterhaltung der öffentlichen Sicherheit und Ordnung zuständig waren und sich – wenn auch nur sporadisch – an der Kriminalitätsbekämpfung beteiligten. Daher erscheint es durchaus gerechtfertigt, zumindest die Praetorianer und die Stadtkohorten als Vorstufen der modernen Polizei zu betrachten, wobei dies insbesondere in Bezug auf die heutzutage bei geschlossenen Einsätzen zum Einsatz kommende Bereitschaftspolizei gilt.352 Betrachtet man allerdings die Organisation der öffentlichen Sicherheit außerhalb der Metropole Rom, dann ergibt sich ein völlig anderes Bild. Hier gab es zwar in der Kaiserzeit verstärkte Bemühungen, durch Militäreinsätze sowie durch die Einrichtung von Militärposten an den großen Straßen das Banditentum auf dem Lande zu bekämpfen, allerdings waren diese in der Regel wenig effektiv.353 Auf der lokalen Ebene existierten au- ßerdem Milizen und aus der Bürgerschaft rekrutierte Hilfsmannschaften, die unter der Leitung der zuständigen Magistrate oder Statthalter anlassbezogen Sicherheits- und Ordnungsaufgaben übernahmen. Große Landgüter wurden zudem in der Regel durch private Wachmannschaften aus Sklaven bzw. im Fall von kaiserlichen Domänen von Soldaten gesichert. Auch wenn diese Gruppierungen sicherlich sicherheitsrelevante, polizeinahe Aufgaben erledigten, so muss aber dennoch festgehalten werden, dass eine Institution, die auch nur annähernd der Polizei im modernen Wortsinne entsprach, außerhalb der römischen Stadtgrenzen in der Antike sicherlich nicht existierte.354 Und da die Praetorianer, die Stadtkohorten und die ‚Vigiles‘ im Zuge der Verlegung der Hauptstadt nach Konstantinopel im 4. 350 Vgl. Nippel, Aufruhr und ‚Polizei‘ in der Römischen Republik, S. 161, S. 163, S. 165 f. 351 Vgl. Fuhrmann, Policing the Roman Empire, S. 117, S. 127ff.; Nippel, Aufruhr und ‚Polizei‘ in der Römischen Republik, S. 167ff. 352 Vgl. Nippel, Aufruhr und ‚Polizei‘ in der Römischen Republik, S. 167. 353 Nippel, Aufruhr und ‚Polizei‘ in der Römischen Republik, S. 169 f.; Fuhrmann, Policing the Roman Empire, S. 171ff.; Riege, Kleine Polizei-Geschichte, S. 12. 354 Vgl. Fuhrmann, Policing the Roman Empire, S. 9. 1. Geschichte der Polizei 85 Jahrhundert n. Chr. aufgelöst wurden, gilt diese Einschätzung auch für das Rom der Spätantike.355 Das Mittelalter Das Mittelalter, das in Bezug auf Europa üblicherweise auf den Zeitraum zwischen dem Beginn des 6. Jahrhunderts und dem Ende des 15. Jahrhunderts datiert wird356, umfasste eine so große Vielzahl und Vielfalt an Kulturen, dass selbst ein grober Überblick über die Organisation der inneren Sicherheit im Rahmen dieses Kapitels kaum möglich erscheint. Gleichwohl wurde das mittelalterliche Europa stark durch zwei Entwicklungen geprägt, die durchaus in ähnlicher Form in fast allen Teilen Europas stattfanden, nämlich (1) die Durchsetzung von feudalen Gesellschafts- und Wirtschaftsstrukturen und (2) die Entstehung und das Wachstum von Städten357, so dass damit zusammenhängend gewisse Parallelen zwischen den verschiedenen europäischen Gesellschaften und ihrer Sicherheitsarchitektur erkennbar werden. Im Allgemeinen muss insbesondere für das frühe Mittelalter davon ausgegangen werden, dass es in den meisten Regionen keine der heutigen Polizei entsprechende Institution gab, dass sich das bereits oben angesprochene, in der Antike dominierende „self-help model“358 der inneren Sicherheit fortsetzte und dass „the primary responses to wrongdoings […] doubtless came from the victim, the victim’s kin and the community“359. Im mittelalterlichen Kontext spiegelt sich dies auch im Fehdewesen als legitimes Instrument zur eigenmächtigen Rechtsdurchsetzung wider.360 Gleichwohl setzte sich im Laufe der Zeit aufgrund des weitverbreiteten Missbrauchs dieses Instruments und der oftmals damit verbundenen Gewaltspirale zunehmend die Auffassung durch, dass solche Konflikte rechtlich reguliert b) 355 Vgl. Nippel, Aufruhr und ‚Polizei‘ in der Römischen Republik, S. 170 f. 356 Vgl. z. B. G. Lubich, Das Mittelalter, Paderborn u. a. 2010, S. 16 f. 357 Vgl. z. B. H.-W. Goetz, Leben im Mittelalter – vom 7. bis zum 13. Jahrhundert, 7. Aufl., München 2002, S. 115ff., S. 201ff. 358 Fuhrmann, Policing the Roman Empire, S. 8. 359 Rawlings, Policing before the police, S. 47. 360 Vgl. C. Reinle, Fehdewesen, in: Historisches Lexikon Bayerns, München 2013, S. 1ff., http://www.historisches-lexikon-bayerns.de/artikel/artikel_45339 (Zugriff: 12.2.2018); J. Grutzpalk, Blood Feud and Modernity: Max Weber’s and Émile Durkheim’s Theories, in: Journal of Classical Sociology, 2. Jg. (2002), Nr. 2, S. 115ff. III. Historische Grundlagen 86 und von einer übergeordneten Instanz gelöst werden sollten, so dass „[d]ie Bekämpfung des Fehdewesens […] in den ersten Jahrhunderten des Mittelalters den Mittelpunkt der inneren Staatstätigkeit [bildete]“.361 Der Erfolg dieser auf die Aufrechterhaltung der öffentlichen Ordnung und Sicherheit abzielenden Bemühungen war allerdings gering, weil die Zuständigkeit hierfür im für das Mittelalter typischen Feudalsystem auf eine Vielzahl von Landesfürsten und Grundherren verteilt war. Diese verfügten zwar über bewaffnetes Personal und konnten nahezu willkürlich über ihre Untertanen herrschen, allerdings konnten sie die Fehdeführung zu ihrem eigenem Vorteil nutzen und hatten daher oftmals wenig Interesse an ihrer effektiven Bekämpfung sowie ganz allgemein an der Verbesserung der Sicherheitslage der Bevölkerung.362 Das Fehlen von entsprechenden Sicherheitsorganen und die damit einhergehende, unbefriedigende Sicherheitslage spiegelten sich nicht zuletzt in der starken Gefährdung von Reisenden wider, die dazu führte, dass wohlhabende Personen sich bei Reisen oftmals ein ‚bewaffnetes Geleit‘ vom König oder Landesfürsten gegen Entgelt stellen ließen.363 Polizeiähnliche Institutionen entstanden allerdings in den mittelalterlichen Städten als weitgehend autonome Zweckgemeinschaften, deren Bürger ein starkes Interesse an der Aufrechterhaltung der öffentlichen Ordnung im Stadtgebiet hatten, um dort möglichst gefahrlos leben und ungestört einer Erwerbstätigkeit nachgehen zu können.364 Während in der ersten Hälfte des Mittelalters in der Regel noch auf professionelle Sicherheitskräfte verzichtet wurde und die Sicherheitsaufgaben als „communal policing“ von der Bürgerschaft bzw. von den Angehörigen der Innungen, Zünfte und Gilden erledigt wurden, setzte dann ab dem 13. Jahrhundert eine zunehmende Zentralisierung der Zuständigkeit für die öffentliche Sicherheit und Ordnung ein.365 Unter der Leitung einer in der Regel für einen bestimmten Zeitraum gewählten, ehrenamtlich tätigen Person oder Personengruppe – in England war dies oftmals der ‚constable‘, im deutsch- 361 Vgl. Riege, Kleine Polizei-Geschichte, S. 13ff. (Zitat: S. 15); Reinle, Fehdewesen, S. 4. 362 Vgl. Reinle, Fehdewesen, S. 3 f. 363 Vgl. Riege, Kleine Polizei-Geschichte, S. 17 f. 364 Vgl. Harnischmacher, Semerak, Deutsche Polizeigeschichte, S. 8ff.; Riege, Kleine Polizei-Geschichte, S. 16 f. 365 Vgl. Rawlings, Policing before the police, S. 47ff. (Zitat: S. 49). 1. Geschichte der Polizei 87 sprachigen Raum der Magistrat oder der Stadtrat366 – wurde dann besoldetes Sicherheitspersonal beschäftigt, dessen Anzahl und Funktion in den verschiedenen Städten aber sehr unterschiedlich ausfiel. So zählt beispielsweise Paul Riege neben Torwächtern und Stadtknechten auch Trabanten, Spießer, Aufbieter und Nachtwächter zu den Sicherheitskräften, während Robert Harnischmacher und Arved Semerak Rats- und Stadtdiener, gehende und reitende Knechte, Büttel, Bettelvögte, Untervögte, reisige Knechte, Landreiter, Pförtner und Schließer anführen.367 Eine anschauliche Beschreibung der Organisation der öffentlichen Sicherheit in einer mittelalterlichen Stadt an der Schwelle zur Neuzeit gibt Andrea Bendlage für die Reichsstadt Nürnberg im 15. und 16. Jahrhundert.368 Hier lag die Verantwortung für die Aufrechterhaltung der öffentlichen Ordnung bei den drei vom Stadtrat aus ihrem Kreis bestimmten Kriegsherren, die diese Funktion in Abstimmung mit dem Rat und unter Einsatz der drei ihnen unterstellten, obersten Hauptleute sowie von hauptamtlichen Polizeidienern erledigten. Auf der Ebene der acht Stadtviertel lag die Verantwortung für die öffentliche Sicherheit bei den aus der Nürnberger Oberschicht gewählten, den obersten Hauptleuten unterstellten Viertelsmeistern, ihren Vertretern sowie den ihnen untergebenen Gassenhauptleuten. Die zentralen Sicherheitsakteure im Alltag waren allerdings die mehr als 100 hauptamtlichen Polizeidiener, die sich im Wesentlichen aus ca. zehn Stadtknechten und Stadtbütteln, jeweils mehreren Dutzend Stadtschützen und Nachtwächtern sowie einigen Turmhütern zusammensetzten und zu deren Aufgaben insbesondere Streifendienste, Verhaftungen, Waffenkontrollen, gerichtliche Vorladungen, Gefangenenüberführungen, Wachdienste in Gefängnissen und an der Stadtmauer sowie die Aufsicht bei Jahrmärkten, Halsgerichten und Exekutionen gehörten. Auch wenn Andrea Bendlage von einem „relativ bescheidenen Nürnberger Polizeiapparat“ spricht und zudem feststellt, dass der Stadtrat „seinen Anspruch auf Durchsetzung obrigkeitlicher Sicherheits- und Ordnungsvorstellungen mit seinem Polizeipersonal in der Alltagspraxis nicht gradlinig 366 Vgl. Rawlings, Policing before the police, S. 49ff.; Harnischmacher, Semerak, Deutsche Polizeigeschichte, S. 9; A. Bendlage, Städtische Polizeidiener in der Reichsstadt Nürnberg im 15. und 16. Jahrhundert, in: M. Dinges, F. Sack [Hrsg.], Unsichere Großstädte? Vom Mittelalter bis zur Postmoderne, Konstanz 2000, S. 89. 367 Vgl. Riege, Kleine Polizei-Geschichte, S. 17; Harnischmacher, Semerak, Deutsche Polizeigeschichte, S. 9. 368 Vgl. Bendlage, Städtische Polizeidiener in der Reichsstadt Nürnberg, S. 89ff. III. Historische Grundlagen 88 und konsequent durchsetzen [konnte]“369, so kann aber dennoch festgehalten werden, dass das spätmittelalterliche Nürnberg – wie viele andere spätmittelalterliche Städte auch370 – dauerhaft und in erheblichem Ausmaß über professionelles, besoldetes, mit polizeilichen Aufgaben betrautes Sicherheitspersonal und damit – zumindest einem weiten Begriffsverständnis folgend – zweifelsohne über eine Polizei verfügte. Die Frühe Neuzeit Zu Beginn der Frühen Neuzeit ab etwa dem 16. Jahrhundert371 setzte sich in den deutschsprachigen Gebieten zunächst das eben beschriebene mittelalterliche System der inneren Sicherheit weitgehend unverändert fort.372 Eine Veränderung wird dann allerdings ab der zweiten Hälfte des 17. Jahrhunderts deutlich, als die Landesherren vor dem Hintergrund der während des Dreißigjährigen Krieges erfahrenen Verwüstungen und Kriegsgräuel zunehmend ein Herrschaftsverständnis entwickelten, das darauf abzielte, in ihrem Herrschaftsbereich „Ordnung nicht mehr nur zu erhalten, sondern zu gestalten: Die Generativität der Bevölkerung und die Wirtschaft zu beleben, für die Armen zu sorgen, die Bildung zu fördern und die künftige Sicherheit des Staates und seiner Bürger zu gewährleisten“373. Um den sich darin widerspiegelnden, „auf omnipotente Verfügungsqualität dringende[n] Polizierungs-Anspruch[s] von seiten der Obrigkeiten“374 durchzusetzen, wurden nicht nur die aus dem Feudalsystem resultierenden Privilegien und Ordnungszuständigkeiten des Adels und der Kirchen sowie die Autonomie der Städte beschnitten, sondern zudem schrittweise zivile Sicherheitsinstitutionen geschaffen, die auch explizit als Polizei bzw. Policey bec) 369 Bendlage, Städtische Polizeidiener in der Reichsstadt Nürnberg, S. 97. 370 Vgl. hierzu z. B. die Angaben zur Polizeidichte in den mittelalterlichen Städten Augsburg, Köln, Siena, Venedig, Florenz und Bordeaux bei Bendlage, Städtische Polizeidiener in der Reichsstadt Nürnberg, S. 91 f. (Fußnote 24) m. w. N. 371 Vgl. z. B. L. Schorn-Schütte, Geschichte Europas in der Frühen Neuzeit – Studienhandbuch 1500-1789, Stuttgart 2009, S. 15ff.; A. Vera, Spekulationsblasen in der frühen Neuzeit – Ein systematischer Vergleich der Ursachen, Mechanismen und Auswirkungen der Mississippi und der South Sea Bubble, Lohmar u. a. 2015, S. 47. 372 Vgl. Harnischmacher, Semerak, Deutsche Polizeigeschichte, S. 15ff.; Riege, Kleine Polizei-Geschichte, S. 20. 373 Leßmann-Faust, Geschichte der Polizei, S. 11. 374 P. Nitschke, Die Polizierung aller Lebensbereiche, S. 37. 1. Geschichte der Polizei 89 zeichnet wurden.375 Diese Entwicklung fand allerdings nicht plötzlich statt, sondern vollzog sich in vielen kleinen Schritten über einen Zeitraum von mehr als 200 Jahren. Diese Entwicklung lässt sich gut am Beispiel des Königreichs Preußen darstellen, das sich im Laufe des 18. Jahrhunderts zu einer europäischen Großmacht entwickelte und aufgrund der hohen Personalstärke und Leistungsfähigkeit seiner Armee und seiner Verwaltung oftmals als klassischer „Militär- und Beamtenstaat“ charakterisiert worden ist.376 Allerdings verzögerte gerade die starke Präsenz von militärischen Kräften in allen größeren preußischen Städten zunächst die Entwicklung einer eigenständigen Polizei, da die öffentliche Ordnung durch das Heer gewährleistet werden konnte. Dementsprechend umfasste beispielsweise die Berliner Polizei im Jahr 1735 bei einer Zivilbevölkerung von ca. 65.000 Personen und einer Militärbevölkerung von ca. 20.000 Personen lediglich zwei Polizeimeister und sechs Polizeidiener, die allesamt Militärinvaliden waren, und auch im Jahr 1780, als die Zivilbevölkerung sich auf ca. 110.000 Personen und die Militärbevölkerung auf ca. 30.000 Personen belief, versahen lediglich 20 Militärinvaliden als Polizeidiener ihren Dienst.377 Hinzu kamen ab dem Jahr 1742 jeweils ein nebenberuflicher ‚Commisaire de Quartier‘ in jedem der 18 Berliner Bezirke sowie etwa 40 nebenberufliche Nachtwächter, die zusammen mit den hauptberuflichen Polizeidienern den zivilen Sicherheitsapparat den Stadt Berlin bildeten, der wiederum Modellcharakter für andere preußische Städte hatte.378 Diese geringe Größe der Polizei war aber nicht nur auf die starke Militärpräsenz zurückzuführen, sondern auch auf das geringe Ausmaß an innergesellschaftlichen gewaltsamen Konflikten und Sicherheitsproblemen in den vorindustriellen Städten Preußens, die zumindest bis zum Ende des 18. Jahrhunderts auch ohne einen weiteren Ausbau der Polizei bewältigt werden konnten.379 375 Vgl. Leßmann-Faust, Geschichte der Polizei, S. 11; Nitschke, Die Polizierung aller Lebensbereiche, S. 37ff. und S. 42ff. 376 Vgl. Knöbl, Polizei und Herrschaft, S. 74ff. 377 Vgl. Funk, Polizei und Rechtsstaat, S. 25; Leßmann-Faust, Geschichte der Polizei, S. 11; Knöbl, Polizei und Herrschaft, S. 76 und S. 79; K. Schwieger, Militär und Bürgertum – Zur gesellschaftlichen Prägkraft des preußischen Militärsystems im 18. Jahrhundert, in: D. Blasius [Hrsg.], Preußen in der Deutschen Geschichte, Königstein 1980, S. 186. 378 Vgl. Knöbl, Polizei und Herrschaft, S. 80; Riege, Kleine Polizei-Geschichte, S. 25; Harnischmacher, Semerak, Deutsche Polizeigeschichte, S. 31 f. 379 Vgl. Knöbl, Polizei und Herrschaft, S. 80ff. III. Historische Grundlagen 90 In Bezug auf die ländlichen Regionen Preußens, in denen der Großteil der Bevölkerung lebte und die nicht durch eine ständige und massive Militärpräsenz geprägt waren, ergibt sich ein recht ähnliches Bild. Der zivile Sicherheitsapparat bestand aus von den Gutsherren beschäftigten Polizeidienern sowie dem Landrat als unterster staatlicher Verwaltungsebene unterstellten Landdragonern bzw. Polizeiausreitern, die zwar in gewissem Umfang polizeiliche Aufgaben übernahmen, die jedoch wegen ihrer geringen Zahl nur unwesentlich zur inneren Sicherheit beitragen konnten.380 Allerdings waren ländliche Unruhen im vorindustriellen Preußen eher selten und konnten stets durch den Einsatz von herbeigerufenen Militäreinheiten niedergeschlagen werden, und auch die allgemeine Kriminalität stellte trotz des nicht unerheblichen Ausmaßes an Bandenkriminalität keine ernsthafte Bedrohung der gesellschaftlichen Ordnung dar, so dass ein Ausbau der polizeilichen Strukturen verzichtbar erschien.381 Zusammenfassend lässt sich folglich in Bezug auf den Entwicklungsstand der Polizei in Preußen am Vorabend der Moderne festhalten, dass „eine Modernisierung des Herrschaftsapparates im Sinne einer Verpolizeilichung von Konflikten also noch nicht stattgefunden [hatte]. […] Eine moderne bürokratische Polizei, die in der Regel ohne Rückgriff auf das Militär ihren Sicherheitsaufgaben nachkam, war weder in den Städten noch auf dem Lande vorhanden.“382 Das Zeitalter der Revolution und des Kapitals Da das 19. Jahrhundert als „der Epochennomenklatur entglitten“383 gilt, ist die Bezeichnung der Periode zwischen dem Beginn der Europäischen Moderne, der in der Regel auf das Jahr 1789 datiert wird, und der Gründung des Deutschen Kaiserreichs im Jahr 1871 ein schwieriges Unterfangen. Die d) 380 Vgl. Knöbl, Polizei und Herrschaft, S. 83ff. 381 Vgl. Knöbl, Polizei und Herrschaft, S. 86ff.; Evans, Polizei, Politik und Gesellschaft, S. 611 f.; U. Danker, Räuberbanden im alten Reich um 1700 – Ein Beitrag zur Geschichte von Herrschaft und Kriminalität in der Frühen Neuzeit, 2 Bände, Frankfurt a. M. 1988, S. 433; U. Danker, Bandits and the state: Robbers and the authorities in the Holy Roman Empire in the late seventeenth and eighteenth centuries, in: R. J. Evans [Hrsg.], The German Underworld: Deviants and Outcasts in German History, London 1988, S. 75ff. 382 Knöbl, Polizei und Herrschaft, S. 90. 383 J. Osterhammel, Die Verwandlung der Welt: eine Geschichte des 19. Jahrhunderts, Sonderausgabe, München 2011, S. 89. 1. Geschichte der Polizei 91 hier gewählte Bezeichnung basiert auf Eric J. Hobsbawms Dreiteilung des ‚langen‘ 19. Jahrhunderts in ein Zeitalter der Revolution (1789-1848), eines des Kapitals (1848-1875) und eines des Imperiums (1875-1914)384 und umfasst ungefähr die ersten beiden angeführten Zeitalter. In den deutschsprachigen Gebieten waren dabei aus polizeihistorischer Sicht vor allem zwei Entwicklungen in den ersten Jahrzehnten dieser Epoche und damit am Übergang vom 18. zum 19. Jahrhundert von Bedeutung. Zum einen fand nach der verheerenden Niederlage Preußens gegen das Napoleonische Frankreich im Jahr 1806 eine umfassende Reform und Modernisierung der preußischen öffentlichen Verwaltung (‚Stein-Hardenbergsche Reformen‘)385 statt, die auch die Polizei als Teil dieser Verwaltung betraf. Zum anderen sahen sich die Staaten im deutschsprachigen Raum im Zuge der einsetzenden Industrialisierung sowie als Folge eines rasanten Bevölkerungswachstums und der eben angesprochenen Reformen einer steigenden Zahl an mobilen, landlosen, verarmten Menschen gegen- über.386 Diese entwickelten sich im Laufe des 19. Jahrhunderts zunehmend zu einer Herausforderung bei der Aufrechterhaltung der öffentlichen Ordnung387, hatten allerdings nach Einschätzung von Wolfgang Knöbl bis ca. 1870 „unmittelbar keine großen Auswirkungen auf die Polizei“388. Für die preußische Polizei war zunächst die im Rahmen der ‚Stein-Hardenbergschen Reformen‘ neu eingeführte Städteordnung von 1808 von Bedeutung, die die weitgehende städtische Autonomie insofern einschränkte, als sie die Polizeiangelegenheiten dem Verantwortungsbereich des monarchischen Staates zuordnete.389 Der Staat konnte diesen Aufgabenbereich zwar in Auftragsverwaltung den Städten übertragen, allerdings 384 Vgl. E. J. Hobsbawm, The Age of Revolution: 1789-1848, London 2010 (Erstver- öffentlichung: 1962); E. J. Hobsbawm, The Age of Capital: 1848-1875, London 2010 (Erstveröffentlichung: 1975); E. J. Hobsbawm, The Age of Empire: 1875-1914, London 2010 (Erstveröffentlichung: 1987). 385 Vgl. z. B. I. Mieck, Preußen von 1807 bis 1850: Reformen, Restauration und Revolution, in: O. Büsch [Hrsg.], Handbuch der preußischen Geschichte, Bd. II: Das 19. Jahrhundert und große Themen der Geschichte Preußens, Berlin u. a. 1992, S. 16ff. 386 Vgl. W. Treue, Preußens Wirtschaft vom Dreißigjährigen Krieg bis zum Nationalsozialismus, in: O. Büsch [Hrsg.], Handbuch der preußischen Geschichte, Bd. II: Das 19. Jahrhundert und große Themen der Geschichte Preußens, Berlin u. a. 1992, S. 494ff. 387 Vgl. Leßmann-Faust, Geschichte der Polizei, S. 11 f. 388 Knöbl, Polizei und Herrschaft, S. 239. 389 Vgl. Knöbl, Polizei und Herrschaft, S. 92 f.; Funk, Polizei und Rechtsstaat, S. 27 f. III. Historische Grundlagen 92 geschah dies nur selten. Vielmehr wurden in den 25 wichtigsten Städten Preußens stattdessen staatliche Polizeiverwaltungen – so genannte ‚Königliche Polizeidirektionen‘ – eingerichtet, die unmittelbar dem Staat unterstanden, deren Kosten aber von der Stadt getragen werden mussten, was sich nachteilig auf ihre Akzeptanz, Ausstattung und Leistungsfähigkeit auswirkte. Dementsprechend blieb zum einen die Polizeidichte in den Städten bis zur Mitte des 19. Jahrhunderts mit zwischen 25 und 50 Polizeibeamten je 100.000 Einwohnern äußerst niedrig, zum anderen waren diese wenigen Polizisten in der Regel schlecht ausgebildet und bezahlt390, so dass Ralph Jessen von einer „desolate[n] Lage der Polizeimannschaften“ spricht, die veranschaulicht, „wie begrenzt trotz aller Verwaltungsreformen die Durchgriffstiefe der Staatsmacht auf den Alltag der Unterschichten blieb“391. Angesichts des eher geringen Konfliktpotenzials im städtischen Umfeld und der Möglichkeit, bei Bedarf – insbesondere bei kollektiven Unruhen und Protesten – das Militär als Ordnungsmacht im Innern einzusetzen, stellten die Defizite der städtischen Polizei aber zunächst noch kein gravierendes Problem dar.392 Das andere, aus polizeilicher Sicht zentrale Element der ‚Stein-Hardenbergsche Reformen‘ war das Gendarmerie-Edikt von 1812, das die Einrichtung einer Gendarmerie nach französischem Vorbild als Landpolizei vorsah, die einem Kreisdirektor als staatlichem Beamten und Kommissar des monarchischen Staates unterstand.393 Diese „diszipliniert auftretende, hart durchgreifende Institution“394 sollte zunächst mit einem durchaus beachtlichen Personalkörper von ca. 8.900 ehemaligen Unteroffizieren mit mindestens zwölfjähriger Militärerfahrung – d. h. bis zu 50 Gendarmen je Landkreis – ausgestattet werden.395 Obwohl auch die anderen deutschen Staaten in der Folgezeit dem preußischen Vorbild folgten und Gendarmerien einrichteten396, blieb ihr Einfluss auf die innere Sicherheit wegen des 390 Vgl. Leßmann-Faust, Geschichte der Polizei, S. 13; Knöbl, Polizei und Herrschaft, S. 213ff.; Jessen, Polizei im Industrierevier, S. 30 f.; Funk, Polizei und Rechtsstaat, S. 43ff.; Evans, Polizei, Politik und Gesellschaft, S. 614. 391 Jessen, Polizei im Industrierevier, S. 31. 392 Vgl. Funk, Polizei und Rechtsstaat, S. 46ff.; Leßmann-Faust, Geschichte der Polizei, S. 13; Knöbl, Polizei und Herrschaft, S. 93 und S. 97. 393 Vgl. Funk, Polizei und Rechtsstaat, S. 41ff.; Knöbl, Polizei und Herrschaft, S. 93ff. 394 Leßmann-Faust, Geschichte der Polizei, S. 14. 395 Vgl. Jessen, Polizei im Industrierevier, S. 28; Lüdtke, Gemeinwohl, Polizei und Festungspraxis, S. 157 f. 396 Vgl. Leßmann-Faust, Geschichte der Polizei, S. 14; Evans, Polizei, Politik und Gesellschaft, S. 612 f. 1. Geschichte der Polizei 93 Widerstands des Landadels, das darin zu Recht eine Beschneidung ihrer bisherigen Privilegien sah, sowie auch des Militärs, das die Gendarmerie als Konkurrenz betrachtete, begrenzt.397 Dies zeigte sich insbesondere darin, dass die preußischen Gendarmen bereits 1815/16 den dem Landadel eng verbundenen Landräten unterstellt wurden und dass ihre Zahl bis 1820 auf ca. 1.300 Mann gesunken war und bis zur Jahrhundertmitte auf diesem Niveau stagnierte. Insofern vermutet Reinhart Koselleck wohl zu Recht, dass die Funktion der Gendarmen eher darin bestand, „an die Wirklichkeit des Staates zu erinnern, als dessen Befehlen unmittelbar Wirksamkeit zu verschaffen“398. Zu dieser Einschätzung passt auch Ralph Jessens Einschätzung, dass „Preußen zum Zeitpunkt der Revolution [von 1848/49] über die mit Abstand schwächste Polizei aller deutschen Staaten [verfügte]“399 und – auch unter Berücksichtigung der städtischen Polizei – somit „gewiß nicht als Polizeistaat gelten [konnte]“400. Und auch Elaine G. Spencer kommt zu der wenig schmeichelhaften Einschätzung: „Before 1848, Prussia was a poorly policed society“401. Dieser Zustand änderte sich dann allerdings im Jahr 1848 zumindest für die Hauptstadt Berlin, als der König angesichts des Versagens sowohl der Polizei wie auch des Militärs bei der Aufrechterhaltung der öffentlichen Ordnung während der revolutionären Unruhen im März 1848 und der angespannten politischen Lage einer grundlegenden Reform des Berliner Polizeiwesens zustimmte, die zur Gründung der Berliner Schutzmannschaft im Juli 1848 führte.402 Diese orientierte sich prinzipiell am Vorbild der seit 1829 in London agierenden Metropolitan Police403 und war dementsprechend blau uniformiert, um ihren zivilen – d. h. nicht-militärischen – Charakter zu betonen, allerdings war sie im Gegensatz zum englischen Vorbild anstatt mit Knüppeln sehr wohl mit Säbeln und Schusswaffen ausgestattet. Das zentrale Merkmal der neuen Berliner Schutzmannschaft war allerdings 397 Vgl. Funk, Polizei und Rechtsstaat, S. 42 f.; Knöbl, Polizei und Herrschaft, S. 94ff.; R. Koselleck, Preußen zwischen Reform und Revolution: allgemeines Landrecht, Verwaltung und soziale Bewegung von 1791 bis 1848, München 1989 (Erstveröffentlichung: 1967), S. 203ff. 398 Koselleck, Preußen zwischen Reform und Revolution, S. 461. 399 Jessen, Polizei im Industrierevier, S. 29. 400 Jessen, Preußische Polizei und Arbeiterschaft, S. 49. 401 E. G. Spencer, Police-Military Relations in Prussia, 1848–1914, in: Journal of Social History, 19. Jg. (1985), Nr. 2, S. 305. 402 Vgl. Eibich, Polizei, Gemeinwohl und Reaktion, S. 63ff.; Jessen, Polizei im Industrierevier, S. 57ff.; Leßmann-Faust, Geschichte der Polizei, S. 15; Funk, Polizei und Rechtsstaat, S. 61ff.; Knöbl, Polizei und Herrschaft, S. 224ff. 403 Vgl. Emsley, The birth and development of the police, S. 72ff. III. Historische Grundlagen 94 ihre hohe Personalstärke, die zunächst ca. 1.800 Mann betrug, was einer Versechsfachung der bisherigen Polizeidichte entsprach, und ihre ständige Präsenz in der Öffentlichkeit, so dass ihre Funktion nun nicht mehr „die temporäre Unterdrückung von Unruhen, sondern die ständige flächendeckende und tendenziell präventiv wirkende Kontrolle der Berliner Einwohnerschaft war“404. Wolfgang Knöbl stellt daher treffend fest: „Damit war im revolutionären Berlin erstmals eine moderne Polizei in Preußen entstanden“405. Nach dem Ende der Revolution erfolgte eine weitere Militarisierung der Schutzmannschaft, die sich in der nahezu ausschließlich auf Militärveteranen abzielenden Rekrutierungspolitik sowie in der Kleidung, Bewaffnung und militärischen Disziplinierung der Schutzmänner niederschlug.406 Sie blieb jedoch von der Armee unabhängig, entwickelte sich „zum alleinigen zivilen Träger der Sicherheit in der Stadt“ und löste das Militär als „ersten Garanten [der] nachrevolutionären Ordnung“ ab.407 Weitere wichtige Entwicklungsschritte waren der Ausbau der politischen Polizei, die die bürgerlich-demokratische Opposition und die neu entstehende Arbeiterbewegung überwachen sollte, sowie die Einrichtung einer auf Kriminalitätsbekämpfung spezialisierten Kriminalpolizei, wobei diese nicht-uniformierten Teile der Schutzmannschaft zunächst nur eine geringe Personalstärke aufwiesen und erst ab ca. 1870 deutlich an Bedeutung gewannen.408 Interessanterweise hatte die Berliner Schutzmannschaft allerdings zunächst keine Vorbildfunktion für andere preußische oder deutsche Landesteile oder Städte, wo „das System der ‚inneren Sicherheit‘ […] im wesentlichen unverändert [blieb]“409 und die Aufrechterhaltung der öffentlichen Ordnung im Alltag weiterhin den Magistraten und Junkern oblag.410 Trotz des „wachsende[n] Problemdruck[s] in den fünfziger und sechziger Jahren“ 404 Leßmann-Faust, Geschichte der Polizei, S. 15. 405 Knöbl, Polizei und Herrschaft, S. 229. 406 Vgl. Eibich, Polizei, Gemeinwohl und Reaktion, S. 71ff.; Knöbl, Polizei und Herrschaft, S. 229ff.; Funk, Polizei und Rechtsstaat, S. 63ff.; Spencer, Police-Military Relations in Prussia, S. 306ff. 407 Knöbl, Polizei und Herrschaft, S. 232. 408 Vgl. Leßmann-Faust, Geschichte der Polizei, S. 15; Knöbl, Polizei und Herrschaft, S. 232ff.; Funk, Polizei und Rechtsstaat, S. 67ff.; Evans, Polizei, Politik und Gesellschaft, S. 616 f. 409 Knöbl, Polizei und Herrschaft, S. 239. 410 Vgl. Funk, Die Entstehung der modernen Polizei, S. 57. 1. Geschichte der Polizei 95 spricht Ralph Jessen daher in Bezug auf die Polizeientwicklung in Preußen von einer „Stagnation“.411 Das Deutsche Kaiserreich Ab den 1870er Jahren und damit ab der Gründung des Deutschen Kaiserreichs erreichten dann die Folgen der Industrialisierung – insbesondere die zunehmende gesellschaftliche Differenzierung sowie das massive Wachstum der städtischen Unterschicht und der Arbeiterbewegung – für die innere Sicherheit ein solches Ausmaß, dass der Staat eine Reihe von Maßnahmen ergriff, die die weitere Entwicklung der deutschen Polizei entscheidend prägten.412 Die massiven Veränderungen der personellen, organisatorischen und rechtlichen Rahmenbedingungen der Polizei während der Kaiserzeit, die zwar nicht ausschließlich der Bekämpfung der sozialdemokratischen Arbeiterbewegung dienten, aber doch maßgeblich „im Zusammenhang mit der Formierung einer modernen Arbeiterklasse“ in Deutschland standen, lassen sich Ralph Jessen zufolge zusammenfassen als (1) Wachstum, (2) Verstaatlichung, (3) Professionalisierung, (4) Demilitarisierung und (5) Funktionsverengung.413 (1) Wachstum: Wie Abbildung 1 veranschaulicht, stieg der Personalkörper der staatlichen Polizei im Laufe der Kaiserzeit sehr stark an, wobei dieser massive Anstieg vor allem die städtische Polizei in Preußen betraf, deren Personalstärke um mehr als 800% anstieg.414 Diese Zunahme übertraf das Bevölkerungswachstum deutlich, so dass sich auch die Polizeidichte in den Städten im Betrachtungszeitraum etwa verdoppelte – mit Ausnahme von Berlin, wo die Polizeidichte nahezu unverändert blieb.415 Man erkennt aber, dass auch die Landgendarmerie eine deutliche personelle Verstärkung erfuhr, die allerdings deutlich niedriger ausfiel als in den Städten. Zudem dürfte auch die Anzahl der Polizisten e) 411 Vgl. Jessen, Polizei im Industrierevier, S. 57ff. (Zitat: S. 57). 412 Vgl. Funk, Die Entstehung der modernen Polizei, S. 57ff.; A. Funk, Die Entstehung der Exekutivpolizei im Kaiserreich, in: H.-J. Lange [Hrsg.], Staat, Demokratie und Innere Sicherheit in Deutschland, Opladen 2000, S. 14ff.; Jessen, Polizei im Industrierevier, S. 44ff.; Knöbl, Polizei und Herrschaft, S. 294ff. 413 Vgl. Jessen, Preußische Polizei und Arbeiterschaft, S. 50ff. (Zitat: S. 53). 414 Vgl. Funk, Polizei und Rechtsstaat, S. 213 f.; Jessen, Polizei im Industrierevier, S. 359. 415 Vgl. Jessen, Polizei im Industrierevier, S. 357 Funk, Die Entstehung der modernen Polizei, S. 58; Knöbl, Polizei und Herrschaft, S. 307. III. Historische Grundlagen 96 im kommunalen Dienst deutlich angestiegen sein, allerdings liegen hier keine belastbaren, mit der staatlichen Polizei vergleichbaren, quantitativen Daten vor.416 Insgesamt lässt sich aber konstatieren, dass die Polizei im Laufe der Kaiserzeit eine massive personelle Aufstockung erfuhr, um insbesondere in urbanen Räumen dem Anspruch des Staates gerecht zu werden, „zu jeder Zeit und an jedem Ort der Stadt präsent zu sein, um ordnend und regulierend einzugreifen“417. Anzahl der staatlichen Polizeiexekutivbeamten in Preußen 1868-1913 (2) Verstaatlichung: Im Laufe der Industrialisierung zog ein erheblicher Teil der Landbevölkerung in die neu entstehenden industriellen Zentren, die zum einen Brennpunkte der sozialdemokratischen Arbeiterbewegung und damit auch von Streikaktivitäten waren und die zum anderem in der Regel nicht im Zuständigkeitsbereich der staatlichen Polizei, d. h. der Schutzmannschaften in den Großstädten und der Landgendarmerie auf dem Land, sondern der kommunalen Polizei lagen. Abb. 1: 416 Vgl. Funk, Polizei und Rechtsstaat, S. 213 f.; Jessen, Polizei im Industrierevier, S. 85ff. und S. 356; Leßmann-Faust, Geschichte der Polizei, S. 16 f. 417 Jessen, Polizei im Industrierevier, S. 110. 1. Geschichte der Polizei 97 Um den damit einhergehenden Sicherheitsproblemen sowie dem Kontrollverlust des Staates entgegenzuwirken, erfolgten zunächst ein energischer Ausbau der kommunalen Polizei, staatliche Vorgaben bezüglich der Polizeidichte je Kommune, eine Vereinheitlichung der Einstellungs- und Besoldungspolitik, eine flächendeckende Dislozierung der Polizeibeamten durch die Einrichtung von Polizeiwachen und -revieren und die Einführung von einheitlichen polizeilichen Routinen wie dem Streifendienst. Zudem wurden ab dem Beginn des 20. Jahrhunderts in den wichtigsten Industriestädten, insbesondere im Ruhrgebiet, staatliche Polizeiverwaltungen aufgebaut.418 Auf diese Weise entwickelte sich die Polizei zu einer „exklusiven Funktion des Staates“, die im gesamten Reich und insbesondere in Preußen als dessen „‚starker Arm‘ […] die Maßnahmen der hoheitlichen Verwaltung exekutieren [sollte]“419. (3) Professionalisierung: Die massive personelle Expansion der Polizei im Laufe der Kaiserzeit hatte zur Folge, dass die bisherige, fast ausschließlich auf Militärveteranen und vor allem ehemalige Unteroffiziere abzielende Rekrutierungspraxis rasch an ihre Grenzen stieß. Dementsprechend mussten Zivilisten ohne umfassende militärische Erfahrung eingestellt werden, die zunächst für den Polizeidienst ausgebildet werden mussten, was zur Gründung der ersten Polizeischulen und insgesamt einer deutlichen Verbesserung der Ausbildung führte.420 Darüber hinaus begann die Polizei, mehr oder weniger systematisch an einer nachhaltigen Verbesserung der polizeilichen Eingriffs- und Ermittlungstechniken zu arbeiten, die unterschiedlichste Bereiche betraf, z. B. das Polizeihundewesen, Kampfkunst- und Selbstverteidigungstechniken oder die Daktyloskopie.421 Dies betraf insbesondere auch die Kriminalpolizei, die in den letzten Jahrzehnten des 19. Jahrhunderts nicht nur personell stark ausgebaut, sondern auch organisatorisch ver- 418 Vgl. Jessen, Preußische Polizei und Arbeiterschaft, S. 50 f.; Jessen, Polizei im Industrierevier, S. 85ff.; Knöbl, Polizei und Herrschaft, S. 304ff.; Leßmann-Faust, Geschichte der Polizei, S. 17. 419 Funk, Die Entstehung der Exekutivpolizei, S. 17. 420 Vgl. R. Jessen, Polizei im Kaiserreich – Tendenzen und Grenzen der Demilitarisierung und „Professionalisierung“, in: H.-J. Lange [Hrsg.], Die Polizei der Gesellschaft – Zur Soziologie der Inneren Sicherheit, Opladen 2003, S. 20ff.; Knöbl, Polizei und Herrschaft, S. 307ff.; Spencer, Police-Military Relations in Prussia, S. 312 f. 421 Vgl. Jessen, Preußische Polizei und Arbeiterschaft, S. 51. III. Historische Grundlagen 98 selbständigt und fachlich-hierarchisch aufgewertet wurde.422 Gleichwohl muss man trotz dieser Professionalisierungstendenzen angesichts des Fehlens eines abgegrenzten, systematisierten, polizeispezifischen Wissensbestands im Sinne einer akademischen Disziplin, der kurzen und sehr praxisnahen Polizeiausbildung und der äußerst breiten Polizeizuständigkeit davon ausgehen, dass die Polizei im Kaiserreich noch weit entfernt davon war, den Status einer Profession zu erlangen, so dass man wohl eher von Professionalisierungsbemühungen oder wie Ralph Jessen von einer „Pseudoprofessionalisierung“ sprechen sollte.423 (4) Demilitarisierung: Auch wenn das Militär während der gesamten Kaiserzeit eine wichtige Rolle als Garant der öffentlichen Ordnung in Deutschland spielte und bei der Bekämpfung von größeren Streiks bzw. der oftmals damit einhergehenden Krawalle und Unruhen angesichts der Überforderung der regulären Polizeikräfte regelmäßig zum Einsatz kam, so erkannten die zivilen Behörden und militärischen Befehlshaber spätestens im Verlauf des großen Bergarbeiterstreiks von 1889, dass die militärische Bekämpfung solcher Konflikte wegen der geringen Flexibilität der Armee und der oftmals äußerst brutalen militärischen Einsatztaktiken die Legitimität des Militärs in Frage stellte und daher inadäquat war.424 Der oben angesprochene, personelle Ausbau der Polizei sollte unter anderem dazu dienen, solche Störungen der öffentlichen Ordnung mit polizeilichen Mitteln bekämpfen zu können. Dies gelang zwar nur eingeschränkt, allerdings war eine „Tendenz zur Verpolizeilichung von [innergesellschaftlichen] Konflikten […] offensichtlich“425. Die Demilitarisierung hatte aber auch eine polizeiinterne Dimension, die sich einerseits aus dem oben konstatierten Rückgang der Rekrutierung von ehemaligen Militärangehörigen ergab, die sich aber auch in 422 Vgl. Leßmann-Faust, Geschichte der Polizei, S. 15 f.; Jessen, Polizei im Kaiserreich, S. 30ff.; Jessen, Polizei im Industrierevier, S. 186ff.; Funk, Die Entstehung der Exekutivpolizei, S. 21; Funk, Die Entstehung der modernen Polizei, S. 61 f.; Funk, Polizei und Rechtsstaat, S. 240ff. 423 Vgl. Jessen, Polizei im Industrierevier, S. 192ff. (Zitat: S. 192); Jessen, Polizei im Kaiserreich, S. 29; Knöbl, Polizei und Herrschaft, S. 309; Spencer, Police-Military Relations in Prussia, S. 313. 424 Vgl. Jessen, Polizei im Industrierevier, S. 76ff.; Jessen, Preußische Polizei und Arbeiterschaft, S. 51 f.; Knöbl, Polizei und Herrschaft, S. 302 f. und S. 314ff.; Leßmann-Faust, Geschichte der Polizei, S. 16. 425 Knöbl, Polizei und Herrschaft, S. 315. 1. Geschichte der Polizei 99 einer deutlich erkennbaren Tendenz widerspiegelte, in der Polizeiausbildung sowie in an Polizeibeamte gerichteten Publikationen ein „eher zivile[s] Polizeiideal“ bzw. ein „eher bürgernahes, weniger militärischautoritär geprägtes Verhaltensideal“426 zu propagieren. Gleichwohl darf diese „Akzentverschiebung im Selbstverständnis“427 auch nicht überbewertet werden. Das Militär „behielt seine dominierende, die polizeilichen Formen der Ordnungswahrung prägende Stellung im Staate“428, so dass man von einem „polizeilichen Militarismus“429 sprechen kann, der sich insbesondere darin zeigte, dass „der einzelne Beamte als Verkörperung staatlicher Autorität wahrgenommen wurde, der militärischen Regeln gehorcht und dem Bürger gegenüber (Rechts-)befehle erteilt und gegebenenfalls (Rechts-)gehorsam erzwingt“.430 Militärische Handlungsmuster und Symbole stellten somit weiterhin eine wesentliche Dimension der Organisationskultur der Polizei dar, die bis in die heutige Zeit das Handeln und Denken von Polizeibeamten nicht nur in Deutschland, sondern auf der ganzen Welt prägt.431 (5) Funktionsverengung: Schließlich setzte sich um die Jahrhundertwende zunehmend die Auffassung durch, dass das traditionell sehr weite Aufgabenverständnis der Polizei im deutschsprachigen Raum, das u. a. auch zahlreiche bau-, wohlfahrts- und gesundheitspolizeiliche Aspekte abdeckte432, zugunsten einer stärkeren Fokussierung auf den Bereich der Gefahrenabwehr aufgegeben werden sollte. Auch dies gelang zunächst nur eingeschränkt, so dass eine Vielzahl an wohlfahrtspolizeilichen Aufgaben bis zum Ende des Kaiserreichs weitergeführt wurde433 und „das Mitschleppen einer Vielzahl verwaltungspolizeilicher Aufgaben kennzeichnend [blieb] für die deutsche Polizei“434. Dennoch führ- 426 Jessen, Polizei im Kaiserreich, S. 28 und S. 33. 427 Jessen, Polizei im Kaiserreich, S. 33. 428 Funk, Die Entstehung der Exekutivpolizei, S. 17. 429 Vgl. Funk, Polizei und Rechtsstaat, S. 287ff. (Zitat: S. 295); Spencer, Police-Military Relations in Prussia, S. 308 f. 430 Funk, Die Entstehung der Exekutivpolizei, S. 22. 431 Vgl. Clark, The Importance of a New Philosophy, S. 642ff.; Hodgson, Police Violence, S. 520ff.; Ivie, Garland, Stress and Burnout in Policing, S. 49ff.; Vera, Organisation und Personalmanagement, S. 65. 432 Vgl. z. B. Reinke, Das Amt der Polizei, S. 13ff.; B. Weinberger, H. Reinke, A diminishing function? A comparative historical account of policing in the city, in: Policing and Society: An International Journal, 1. Jg. (1991), Nr. 3, S. 213ff.; Knöbl, Polizei und Herrschaft, S. 311. 433 Vgl. Leßmann-Faust, Geschichte der Polizei, S. 17 f. 434 Funk, Die Entstehung der Exekutivpolizei, S. 18. III. Historische Grundlagen 100 te diese Entwicklung zu einer klareren Unterscheidung von Polizei und Verwaltung und zu einer deutlichen Verengung der Aufgaben der Polizei auf die Aufrechterhaltung der öffentlichen Ordnung und Sicherheit.435 Im Ergebnis führten diese Entwicklungen im Deutschen Kaiserreich zur Entstehung einer staatlichen Sicherheitsbehörde, deren zentrales Anliegen die Aufrechterhaltung der staatlichen und gesellschaftlichen Ordnung war, die dabei repressiv durch Zwang sowie präventiv durch flächendeckende Kontrolle handelte und die eine institutionelle Form aufwies, „die derjenigen der heutigen Polizei schon nahe kommt“436, so dass man sie – selbst wenn man das heutige Begriffsverständnis zu Grunde legt – als ‚moderne Polizei‘ bezeichnen muss. Der Erste Weltkrieg führte dann allerdings zu einer Ausweitung der polizeilichen Aufgaben bei gleichzeitigen, erheblichen, kriegsbedingten Personalkürzungen, so dass auf lange Sicht eine massive Überlastung dieser Polizei unvermeidlich war.437 Dementsprechend begann die im Mittelpunkt dieser Dissertation stehende Zwischenkriegszeit dann im November 1918 mit der militärischen Niederlage, dem Ende des Deutschen Kaiserreichs und dem totalen Zusammenbruch der deutschen Polizei.438 Die deutsche Zwischenkriegszeit und ihre Sicherheitslage Auch wenn Periodisierungsfragen in der Geschichtswissenschaft in der Regel umstritten und höchst unterschiedlich beantwortet werden, so muss doch in Bezug auf den Zeitraum zwischen dem Ersten und dem Zweiten Weltkrieg konstatiert werden, dass dieser „[i]n seltener Einmütigkeit […] dezidiert als ‚Zwischenkriegszeit‘ gedeutet“439 wird.440 Dies ist angesichts der offensichtlichen, fundamentalen Zäsuren, die die beiden Weltkriege auf globaler, insbesondere aber auf europäischer Ebene darstellen, wenig verwunderlich. Sowohl der Erste Weltkrieg als ‚Urkatastrophe des 20. Jahr- 2. 435 Vgl. Jessen, Preußische Polizei und Arbeiterschaft, S. 52. 436 Funk, Polizei und Rechtsstaat, S. 239. 437 Vgl. Leßmann-Faust, Geschichte der Polizei, S. 18. 438 Vgl. Leßmann-Faust, Die Preußische Schutzpolizei, S. 17; Schmidt, Schützen und Dienen, S. 64. 439 Möller, Europa zwischen den Weltkriegen, S. 1. 440 Vgl. W. L. Bernecker, Europa zwischen den Weltkriegen 1914-1945, Stuttgart 2002, S. 13; Möller, Europa zwischen den Weltkriegen, S. 117ff. 2. Die deutsche Zwischenkriegszeit und ihre Sicherheitslage 101 hunderts‘441 als auch der Zweite Weltkrieg, der den Ersten in nahezu jeder Hinsicht noch in den Schatten stellte, hatten derart gravierende politische, gesellschaftliche und ökonomische Konsequenzen, dass „Kontinuitätslinien, die es in Teilbereichen durchaus gab, im Hinblick auf die gewaltige und gewaltsame Diskontinuität zweitrangig werden“442. Auch wenn in der Geschichtsschreibung die Zusammenfassung der 31 Jahre zwischen 1914 und 1945 zu einer „Epoche der Weltkriege“443, einem „Zeitalter des totalen Kriegs“444 oder zu „Europe’s Second Thirty Years War“445 vermutlich noch populärer ist, so gibt es auch gute inhaltlich-strukturelle Gründe dafür, die ‚friedlichen‘ Jahre zwischen 1918 und 1939 vor allem aus einer europäischen Perspektive als Epoche zu interpretieren.446 Dabei wird die Zwischenkriegszeit in der Regel „als eine Zeit fortdauernder Instabilität, immer wieder aufflammender Krisen der innenpolitischen Systeme wie der internationalen Ordnung“447 gedeutet. Prägende Entwicklungen in dieser Zeit waren die deutliche Verschiebung der politischen, militärischen und ökonomischen Machtverhältnisse zu Lasten von Europa und zu Gunsten der USA, die umfassende, aber inkonsequente Neuordnung des europäischen Staatensystems nach dem Prinzip des homogenen Nationalstaates, die zunehmende Infragestellung demokratischer und liberaler Werte, die zunehmende Verbreitung von totalitären – vor allem faschistischen, nationalsozialistischen und kommunistischen – Bewegungen sowie auf der kulturellen Ebene ein weiterer Säkularisierungs- 441 Vgl. W. J. Mommsen, Die Urkatastrophe Deutschlands – Der Erste Weltkrieg, Stuttgart 2004, S. 14; H. Leidinger, V. Moritz, Der Erste Weltkrieg, Wien u. a. 2011, S. 7; R. Rürup, Weltkrieg – Volkskrieg – Kulturkrieg – Die Bedeutung des Ersten Weltkrieges für die deutsche Geschichte, in: R. Spilker, B. Ulrich [Hrsg.], Der Tod als Maschinist – Der industrialisierte Krieg 1914-1918, Bramsche 1998, S. 13; W. Kruse, Der Erste Weltkrieg, Darmstadt 2009, S. 1; V. Berghahn, Der Erste Weltkrieg, München 2006, S. 17; A. Reimann, Der Erste Weltkrieg – Urkatastrophe oder Katalysator? in: Aus Politik und Zeitgeschichte, 54. Jg. (2004), Nr. 29-30, S. 30. 442 Möller, Europa zwischen den Weltkriegen, S. 117 f. 443 L. Dehio, Deutschland und die Weltpolitik im 20. Jahrhundert, Frankfurt a. M. u. a. 1961, S. 9. Vgl. auch E. Nolte, Der europäische Bürgerkrieg 1917-1945, Frankfurt a. M. u. a. 1987, S. 3. 444 E. J. Hobsbawm, Das Zeitalter der Extreme – Weltgeschichte des 20. Jahrhunderts, München u. a. 1995, S. 37. 445 I. Kershaw, Europe’s Second Thirty Years War, in: History Today, o. Jg. (2005), Nr. 9, S. 10. Vgl. auch F. Stern, Der Westen im 20. Jahrhundert – Selbstzerstörung, Wiederaufbau, Gefährdungen und Gegenwart, Göttingen 2008, S. 9ff. 446 Vgl. Bernecker, Europa zwischen den Weltkriegen, S. 13. 447 Möller, Europa zwischen den Weltkriegen, S. 1. III. Historische Grundlagen 102 schub, eine enorme Orientierungslosigkeit und profunde Verunsicherung breiter Bevölkerungsschichten sowie ein allgegenwärtiges Krisenbewusstsein.448 Im Ergebnis führten diese Faktoren „nicht nur zu einer extremen inneren Labilität der europäischen Staaten, sondern zugleich [zu einer] Instabilität der gesamten internationalen Ordnung jener Zeit“449, die letztlich in den Zweiten Weltkrieg mündete. Da die Zwischenkriegszeit von den beiden Weltkriegen eingerahmt wird, hängt die genaue Datierung auf nationaler Ebene davon ab, wann der betreffende Staat die jeweiligen Kampfhandlungen beendete und wieder eröffnete. Davon abweichend wird der Beginn der deutschen Zwischenkriegszeit üblicherweise nicht auf den 11. November 1918, dem Tag der Unterzeichnung und des Inkrafttretens des Waffenstillstands, sondern auf den 9. November 1918, dem Tag der Ausrufung der Weimarer Republik, datiert, während der deutsche Überfall auf Polen am 1. September 1939 unzweideutig ihr Ende markiert. Unter Berücksichtigung der fundamentalen Zäsur der nationalsozialistischen ‚Machtergreifung‘ oder ‚Revolution‘450 im Jahr 1933, die trotz aller Kontinuitäten für die deutsche Geschichtsschreibung zweifelsohne ihre Berechtigung hat451, führt dies üblicherweise zu einer Zweiteilung der deutschen Zwischenkriegszeit in eine Weimarer Zeit und eine Phase nationalsozialistischer Herrschaft.452 Gleichwohl ist zu berücksichtigen, dass die Weimarer Phase damit mehr als doppelt so lang ist als die NS-Diktatur, so dass diese Zweiteilung bei Betrach- 448 Vgl. Bernecker, Europa zwischen den Weltkriegen, S. 18ff.; Möller, Europa zwischen den Weltkriegen, S. 2ff.; Blaney, Introduction: Policing Interwar Europe, S. 1; W. Hardtwig, Einleitung: Politische Kulturgeschichte der Zwischenkriegszeit, in: W. Hardtwig [Hrsg.], Politische Kulturgeschichte der Zwischenkriegszeit 1918-1939, Göttingen 2005, S. 7ff. 449 Bernecker, Europa zwischen den Weltkriegen, S. 19. 450 Der den Prozesscharakter betonende Begriff der ‚Revolution‘ erscheint in diesem Zusammenhang etwas treffender als der deutlich häufiger verwendete, aber leicht irreführende Begriff der ‚Machtergreifung‘. Vgl. hierzu H. Möller, Weimar – Die unvollendete Demokratie, 4. Aufl., München 1993, S. 216ff.; K. D. Bracher, Die Auflösung der Weimarer Republik, Königstein, 5. Aufl., Düsseldorf 1978 (Erstveröffentlichung: 1955), S. 632 und S. 638; K. Bauer, Nationalsozialismus: Ursprünge, Anfänge, Aufstieg und Fall, Wien u. a. 2008, S. 197; Bernecker, Europa zwischen den Weltkriegen, S. 73; R. Marcowitz, Weimarer Republik 1929-33, Darmstadt 2004, S. 133ff. 451 Vgl. Bernecker, Europa zwischen den Weltkriegen, S. 13; Möller, Europa zwischen den Weltkriegen, S. 118; Hardtwig, Einleitung: Politische Kulturgeschichte der Zwischenkriegszeit, S. 8; N. Frei, Der Führerstaat – Nationalsozialistische Herrschaft 1933 bis 1945, München 2013, S. 7. 452 Vgl. z. B. Bernecker, Europa zwischen den Weltkriegen, S. 37ff. 2. Die deutsche Zwischenkriegszeit und ihre Sicherheitslage 103 tungen der Zwischenkriegszeit – d. h. ohne den Zweiten Weltkrieg – eine gewisse Unausgewogenheit befördern könnte. Um dies zu verhindern und die Rolle der Polizei als staatliches Herrschaftsinstrument über die gesamte deutsche Zwischenkriegszeit hinweg gleichmäßig untersuchen zu können, wird im weiteren Verlauf dieser Dissertation bewusst auf eine solche Zweiteilung verzichtet. Dementsprechend unterscheidet der nun folgende Überblick über die geschichtliche Entwicklung Deutschlands zwischen den Weltkriegen die folgenden vier Phasen. Am Anfang steht (a) die revolutionäre, krisenhafte, von politischer Gewalt geprägte Gründungsphase der Weimarer Republik zwischen 1919 und 1923, an die sich (b) eine relativ stabile – oder zumindest „scheinstabile“453 – Übergangsphase zwischen 1924 und 1929 und (c) eine erneut sehr krisenhafte und gewaltsame, in die Zerstörung der Weimarer Republik mündende Phase zwischen 1930 und 1932 anschließen454, bevor schließlich (d) eine Phase der nationalsozialistischen Herrschaft zwischen 1933 und 1939 folgt. Dabei wird gemäß der thematischen Ausrichtung dieser Dissertation der Schwerpunkt auf die Sicherheitslage gelegt. Die Entwicklung der Polizei wird hingegen nicht genauer behandelt, da diese im vierten Kapitel dann im Detail analysiert wird. Gründung der Weimarer Republik (1918-23) Als ‚Geburtsstunde‘ der Weimarer Republik gilt üblicherweise die Ausrufung der Republik durch den sozialdemokratischen Staatssekretär Philipp Scheidemann am frühen Nachmittag des 9. November 1918 vom Balkon des Reichstags in Berlin aus455, obwohl auch andere Ereignisse – insbesondere die parlamentaristisch ausgerichteten Oktoberreformen des Jahres 1918, die Wahl zur Verfassungsgebenden Nationalversammlung am 19. Jaa) 453 G. Niedhart, Deutsche Geschichte 1918-1933 – Politik in der Weimarer Republik und der Sieg der Rechten, 2. Aufl., Stuttgart u. a. 1994, S. 91. 454 Vgl. z. B. die ähnlichen Gliederungen bei E. Kolb, Deutschland 1918-1933 – Eine Geschichte der Weimarer Republik, München 2010; D. J. K. Peukert, Die Weimarer Republik, Frankfurt a. M. 1987; G. Mai, Die Weimarer Republik, München 2009; D. Gessner, Die Weimarer Republik, Darmstadt 2002; H. Thoß, Demokratie ohne Demokraten? Die Innenpolitik der Weimarer Republik, Berlin 2008. 455 Vgl. Niedhart, Deutsche Geschichte, S. 12, S. 15 und S 23 f.; E. Jesse, Systemwechsel in Deutschland: 1918/19 – 1933 – 1945/49 – 189/90, Köln u. a. 2010, S. 36; V. Ulrich, Die Revolution von 1918/19, München 2009, S. 32ff. III. Historische Grundlagen 104 nuar 1919 oder das Inkrafttreten der Weimarer Reichsverfassung am 14. August 1919 – diesen Anspruch mit einer gewissen Berechtigung erheben könnten.456 Vorausgegangen war diesem Ereignis ein mehrmonatiges, komplexes Wechselspiel zwischen einer Revolution ‚von oben‘ und einer ‚von unten‘. Hierbei gingen Regierung, Militär und Unternehmer ab September 1918 angesichts der sich abzeichnenden militärischen Niederlage ein Bündnis mit der politischen Linken ein und wandelten das Kaiserreich am 28. Oktober 1918 per Verfassungsänderung ‚von oben‘ in eine parlamentarische Monarchie um, um eine sozialistische Revolution ‚von unten‘ zu verhindern. Diese fand dann aber ab Anfang November 1918 getragen von einer lawinenartig anwachsenden, zunehmend radikalisierten, sowohl die Arbeiterschaft wie das Bürgertum umfassenden ‚Friedensbewegung‘ und angestoßen von Meutereien von Marineangehörigen und Soldaten sowie der Bildung von Arbeiter- und Soldatenräten dennoch statt.457 Die so entstandene Weimarer Republik hatte allerdings von Anfang an mit zahlreichen schwerwiegenden Problemen zu kämpfen. Sie stand „in vielfacher Hinsicht unter keinem guten Stern“458 und hatte „in keiner Beziehung einen glückhaften Start“459. Die Schaffung von stabilen, demokratisch legitimierten Strukturen erwies sich für die seit dem 10. November regierende, paritätisch besetzte Koalitionsregierung aus der Sozialdemokratischen Partei Deutschlands (SPD) und der Unabhängigen Sozialdemokratischen Partei Deutschlands (USPD)460 aus verschiedenen Gründen als äu- ßerst schwierig. Problematisch war schon die unterschiedliche politische Ausrichtung der beiden regierenden sozialdemokratischen Parteien – ei- 456 Vgl. Peukert, Die Weimarer Republik, S. 13 f. 457 Vgl. P. Broué, The German Revolution 1917-1923, Leiden 2005 (Erstveröffentlichung: 1971), S. 129ff.; A. Wirsching, Die paradoxe Revolution 1918/19, in: Aus Politik und Zeitgeschichte, o. Jg. (2008), Nr. 50/51, S. 8 f.; Ulrich, Die Revolution, S. 21ff.; Mai, Die Weimarer Republik, S. 13ff.; Kolb, Deutschland, S. 4ff.; Niedhart, Deutsche Geschichte, S. 15ff.; R. Sturm, Weimarer Republik, Informationen zur politischen Bildung, Nr. 261, Bonn 2011, S. 4ff.; T. Balderston, Economics and Politics in the Weimar Republic, Cambridge 2002, S. 2ff.; E. H. Tobin, Revolution and Alienation: The Foundations of Weimar, in: M. N. Dobkowski, I. Wallimann [Hrsg.], Towards the Holocaust: the social and economic collapse of the Weimar Republic, Westport u. a. 1983, S. 156ff. 458 Jesse, Systemwechsel in Deutschland, S. 41. 459 E.-W. Böckenförde, Der Zusammenbruch der Monarchie und die Entstehung der Weimarer Republik, in: K. D. Bracher, M. Funke, H.-A. Jacobsen [Hrsg.], Die Weimarer Republik 1918-1933 – Politik, Wirtschaft, Gesellschaft, Düsseldorf 1987, S. 42. 460 Vgl. Peukert, Die Weimarer Republik, S. 39; Jesse, Systemwechsel in Deutschland, S. 36; Thoß, Demokratie ohne Demokraten, S. 18. 2. Die deutsche Zwischenkriegszeit und ihre Sicherheitslage 105 nerseits die liberalen, parlamentarisch-rechtsstaatlichen Zielen verpflichtete SPD, andererseits die auf eine Fortführung der sozialen Revolution drängende USPD.461 Des Weiteren war die Bevölkerung durch die hohe Zahl an Kriegsopfern dezimiert, von der unerwarteten Kriegsniederlage traumatisiert, durch die kriegsbedingte Inflation und die hohen Kriegsschulden verarmt, von der plötzlichen Abschaffung der Monarchie tief verunsichert und durch die harten Konditionen des Friedensvertrags von Versailles gedemütigt.462 Zudem waren das Militär und große Teile der Beamtenschaft monarchistisch-konservativ orientiert, standen der Demokratie kritisch gegenüber und betrachteten sich eher als Träger eines demokratieund parteiunabhängigen Staates.463 Schließlich galt es, umgehend die katastrophale Ernährungslage zu verbessern, die Umstellung der Kriegs- in eine Friedenswirtschaft sowie die Demobilisierung der Truppen und ihre Wiedereingliederung in das zivile Leben zu bewältigen.464 Dementsprechend kommt Detlef J. K. Peukert zu dem Ergebnis, dass „[d]ie Deutschen ihr republikanisches Experiment zur denkbar ungünstigsten Stunde [wagten], in einem Moment, in dem das politische und soziale System ohnehin einer Zerreißprobe ausgesetzt wurde“465. Angesichts dieser enormen Herausforderungen verwundert es nicht, dass es ab Dezember 1918 zunehmend zu Streiks, Massenprotesten und politischen Umsturzversuchen kam. Auch wenn die sozialdemokratische Regierung die vom linken politischen Lager initiierten Unruhen im Laufe des Frühjahrs 1919 durch reguläre Truppen und ‚rechte‘ Freikorpsformationen niederschlagen ließ und so zumindest vorübergehend für eine Beruhigung der Sicherheitslage sorgte, so spiegelten sich in diesen frühen Auseinandersetzungen bereits die radikalen politischen Zielvorstellungen und Aktionsformen der extremen Linken und Rechten wider, die das innenpo- 461 Vgl. Gessner, Die Weimarer Republik, S. 24ff.; Peukert, Die Weimarer Republik, S. 39ff.; Jesse, Systemwechsel in Deutschland, S. 37ff.; A. Wirsching, Die Weimarer Republik – Politik und Gesellschaft, München 2008, S. 52ff.. 462 Vgl. Böckenförde, Der Zusammenbruch der Monarchie, S. 17ff.; U. Kluge, Die Weimarer Republik, Paderborn u. a. 2006, S. 29ff.; H. Schulze, Das Scheitern der Weimarer Republik als Problem der Forschung, in: K. D. Erdmann, H. Schulze [Hrsg.], Weimar – Selbstpreisgabe einer Demokratie, Düsseldorf 1980, S. 23ff.; Wirsching, Die paradoxe Revolution 1918/19, S. 8. 463 Vgl. Bracher, Die Auflösung der Weimarer Republik, S. 157ff., S. 162ff., 205ff., S. 227ff.; Böckenförde, Der Zusammenbruch der Monarchie, S. 43. 464 Vgl. Jesse, Systemwechsel in Deutschland, S. 37 f.; Ulrich, Die Revolution, S. 44. 465 Peukert, Die Weimarer Republik, S. 16. III. Historische Grundlagen 106 litische Geschehen der Weimarer Republik im Prinzip bis zu ihrem Ende im Jahr 1933 maßgeblich bestimmen sollten.466 Den Anfang machten die so genannten ‚Berliner Weihnachtskämpfe‘, bei denen ein seit November 1918 schwelender Konflikt zwischen der Regierung und einer aus 1.700 Marineangehörigen bestehenden, zu den linken Revolutionären tendierenden ‚Volksmarinedivision‘ eskalierte. Dabei besetzten diese am 23. Dezember 1918 zunächst die Reichskanzlei und stürmten die Berliner Stadtkommandatur. Am 24. Dezember 1918 griffen dann die vom sozialdemokratischen Reichskanzler Friedrich Ebert angeforderten, schwerbewaffneten Truppen des preußischen Kriegsministeriums in das Geschehen ein, denen sich wiederum bewaffnete Arbeiter sowie die von Emil Eichhorn – USPD-Politiker und seit dem 9. November 1918 Berliner Polizeipräsident467 – geführte Sicherheitswehr entgegenstellten. Als sich eine Niederlage der Regierungstruppen abzeichnete, verhinderte Friedrich Ebert diese, indem er noch am gleichen Tag die Einstellung der Kämpfe befahl und den Konflikt auf dem Verhandlungsweg löste.468 Diese vergleichsweise kurze, mit 67 Toten jedoch durchaus verlustreiche Auseinandersetzung war aus verschiedenen Gründen für die weitere Entwicklung äußerst bedeutsam. Zum einen verdeutlichte sie die als ‚Ebert- Groener-Pakt‘469 bezeichnete Zusammenarbeit zwischen der Regierung und der weiterhin monarchistisch orientierten, demokratischen Werten kritisch gegenüberstehenden Obersten Heeresleitung und installierte letztere damit als wichtige innenpolitische Ordnungsmacht.470 Wie Gunter W. Remmling treffend feststellt, „[f]rom then on it was not the life-giving strength of productive labor […], but the death-oriented power of the 466 Vgl. Kolb, Deutschland, S. 30 f. und S. 55ff. 467 Vgl. J. Buder, Die Reorganisation der preußischen Polizei 1918-1923, Frankfurt a. M. u. a. 1986, S. 22; Leßmann-Faust, Die Preußische Schutzpolizei, S. 25 f. 468 Vgl. Sturm, Weimarer Republik, S. 14; Ulrich, Die Revolution, S. 63ff.; Niedhart, Deutsche Geschichte, S. 33; Leßmann-Faust, Die Preußische Schutzpolizei, S. 38 f.; H. Hürten, Bürgerkriege in der Republik – Die Kämpfe um die innere Ordnung von Weimer 1918-1920, in: K. D. Bracher, M. Funke, H.-A. Jacobsen [Hrsg.], Die Weimarer Republik 1918-1933 – Politik, Wirtschaft, Gesellschaft, Düsseldorf 1987, S. 83. 469 Vgl. Jesse, Systemwechsel in Deutschland, S. 37; Gessner, Die Weimarer Republik, S. 8. 470 Vgl. Hürten, Bürgerkriege in der Republik, S. 82; Bracher, Die Auflösung der Weimarer Republik, S. 21 f. 2. Die deutsche Zwischenkriegszeit und ihre Sicherheitslage 107 army that was to exercise the decisive force in the Republic”471. Zum anderen machten die ‚Berliner Weihnachtskämpfe‘ deutlich, dass große Teile der deutschen Arbeiterbewegung an stabilen politischen Verhältnissen interessiert waren und eine umfassende sozialistische Revolution nach sowjetischem Muster ablehnten. Dies galt insbesondere für die SPD, die „[f]earful of the Bolshevik Revolution in Russia moving further westwards […] put the restoration and maintenance of order above everything else.“472 Dies galt aber auch für die Gewerkschaften, die sich bereits am 15. November 1918 mit der Arbeitgeberseite auf den so genannten ‚Stinnes-Legien- Pakt‘ verständigt hatten, der der Arbeiterschaft unter anderem die volle Koalitionsfreiheit, das Recht zum Abschluss von kollektiven Tarifverträgen und ‚den 8-Stunden-Tag‘ zugestand, der aber gleichzeitig die bestehende Eigentumsordnung garantierte und Sozialisierungsforderungen eine Absage erteilte.473 Des Weiteren waren die ‚Berliner Weihnachtskämpfe‘ zwar nicht die zentrale Ursache, aber doch der Anlass für den Austritt der USPD aus dem Rat der Volksbeauftragten, was nicht nur den Bruch der damaligen Koalition mit der SPD bedeutete, sondern auch die endgültige Beendigung der Zusammenarbeit zwischen den beiden sozialdemokratischen Parteien und die irreversible Spaltung der deutschen Arbeiterbewegung.474 Das nun nicht mehr in der Regierung vertretene revolutionäre Lager radikalisierte sich in der Folgezeit, was sich unmittelbar in der Gründung der Kommunistischen Partei Deutschlands (KPD) und den von ihr unterstützten, fälschlicherweise als ‚Spartakus-Aufstand‘ bezeichneten, gewaltsamen Unruhen ab dem 5. Januar 1919 widerspiegelte475, die nach Gottfried Niedhart den Eintritt der Revolution „in ihre blutige Phase“476 markierten. Dabei handelte es sich um einen von der Absetzung des Berliner Polizeipräsidenten und USPD-Politikers Emil Eichhorn angestoßenen, bewaffneten Putschversuch linksradikaler Kräfte, der allerdings nicht nur 471 G. W. Remmling, Prologue: Weimar Society in Retrospect, in: M. N. Dobkowski, I. Wallimann [Hrsg.], Towards the Holocaust: the social and economic collapse of the Weimar Republic, Westport u. a. 1983, S. 7. 472 Evans, Rereading German History, S. 99. 473 Vgl. G. D. Feldman, Das deutsche Unternehmertum zwischen Krieg und Revolution – Die Entstehung des Stinnes-Legien-Abkommens, in: G. D. Feldman [Hrsg.], Vom Weltkrieg zur Weltwirtschaftskrise – Studien zur deutschen Wirtschafts- und Sozialgeschichte 1914–1932, Göttingen 1984, S. 100ff.; Niedhart, Deutsche Geschichte, S. 26 f.; Kolb, Deutschland, S. 20 f. 474 Vgl. Ulrich, Die Revolution, S. 65 f.; Kolb, Deutschland, S. 23; Gessner, Die Weimarer Republik, S. 7. 475 Vgl. Peukert, Die Weimarer Republik, S. 42 f.; Ulrich, Die Revolution, S. 67ff. 476 Niedhart, Deutsche Geschichte, S. 35. III. Historische Grundlagen 108 schlecht geplant war, sondern auch nur halbherzig und dilettantisch durchgeführt wurde.477 Obwohl der Aufstand weitgehend gewaltlos und wenig erfolgversprechend ablief, wurde er von der Regierung durch den Einsatz von regulären Militäreinheiten sowie von auf freiwilliger Basis gebildeten Freikorps unter der Führung der SPD-Politikers Gustav Noske äu- ßerst gewaltsam niedergeschlagen. Gerade der Einsatz von Freikorpseinheiten, „heavily armed bands of right-wing thugs, including many ex-soldiers“478, die sich überwiegend durch eine rechtsradikale politische Gesinnung, eine ablehnende Haltung zur Republik und eine ausgeprägte Bereitschaft zu exzessiver Gewalt bis hin zur Lynchjustiz – wie z. B. der Ermordung von fünf am Putschversuch beteiligten Parlamentären am 11. Januar 1919 sowie vor allem der Führungsfiguren des Spartakusbundes und der soeben gegründeten KPD, Rosa Luxemburg und Karl Liebknecht, am 15. Januar 1919 – auszeichneten, führte zu einer dauerhaften Eskalation der Formen der politischen Auseinandersetzung in der Weimarer Republik.479 Gottfried Niedhart umschreibt dies folgendermaßen: „Physische Gewaltanwendung und politische Morde gehörten fortan zum Signum der politischen Auseinandersetzung in Deutschland.“480 Nach den Wahlen zur Nationalversammlung, die mit einer Regierungskoalition der SPD, der Deutschen Demokratischen Partei (DDP) und der Zentrumspartei und der Wahl Friedrich Eberts zum Reichspräsidenten am 11. Februar 1919 endeten, eskalierte die Gewalt weiter.481 So spiegelte schon die Wahl von Weimar als Tagungsort für die Nationalversammlung nicht zuletzt die angespannte Sicherheitslage in Berlin wider.482 Im Januar und Februar 1919 rückte aber zunächst das Ruhrgebiet in den Fokus der Gewalt, als spontane Massenstreiks und Forderungen der Arbeiterschaft nach einer Sozialisierung wichtiger Branchen und insbesondere des Berg- 477 Vgl. Broué, The German Revolution 1917-1923, S. 227ff. und insb. S. 245ff.; Ulrich, Die Revolution, S. 69ff.; Thoß, Demokratie ohne Demokraten, S. 24ff.; Hürten, Bürgerkriege in der Republik, S. 83 f. 478 Evans, Rereading German History, S. 115. 479 Vgl. Broué, The German Revolution 1917-1923, S. 255ff.; Sturm, Weimarer Republik, S. 14 f.; Thoß, Demokratie ohne Demokraten, S. 25 f.; Peukert, Die Weimarer Republik, S. 43; Ulrich, Die Revolution, S. 73ff. Remmling, Prologue: Weimar Society in Retrospect, S. 6. 480 Niedhart, Deutsche Geschichte, S. 36. 481 Vgl. Sturm, Weimarer Republik, S. 16ff.; Ulrich, Die Revolution, S. 76ff.; Mai, Die Weimarer Republik, S. 25 f.; Niedhart, Deutsche Geschichte, S. 37ff.; Peukert, Die Weimarer Republik, S. 43ff.; Kluge, Die Weimarer Republik, S. 61. 482 Vgl. Kolb, Deutschland, S. 25; Ulrich, Die Revolution, S. 79. 2. Die deutsche Zwischenkriegszeit und ihre Sicherheitslage 109 baus in bewaffnete Auseinandersetzungen umschlugen, die im Auftrag der Regierung von Armee- und Freikorpstruppen mit äußerster Brutalität und zahlreichen Todesopfern niedergeschlagen wurden.483 Ab Ende Februar 1919 verlagerte sich der Schwerpunkt der Auseinandersetzungen dann nach Mitteldeutschland, wo die Arbeiterschaft ähnliche Forderungen wie zuvor im Ruhrgebiet stellte und ebenfalls streikte, bis auch hier Regierungstruppen und Freikorps in die Streikzentren einmarschierten und die Proteste erneut gewaltsam niederschlugen.484 Im April 1919 kam es dann erneut im Ruhrgebiet zu einer Streikwelle, die von Regierungstruppen mit der Verhaftung von zahlreichen Streikführern, jedoch ohne Todesopfer beendet wurde.485 Diese Konflikte verblassen jedoch angesichts der beiden größten Aufstände im Frühjahr 1919, bei denen in Berlin und Bayern bürgerkriegsähnliche Zustände herrschten.486 Der als ‚Berliner Blutmassaker‘ bezeichnete Aufstand begann am 4. März 1919 mit einem Generalstreik, der auf Befehl des sozialdemokratischen Reichswehrministers Gustav Noske von Regierungstruppen und Freikorps mit einem bis dahin nicht gekannten Ausmaß an Gewalt niedergeschlagen wurde. Die Kämpfe sowie die anschließende Verhaftungs- und Exekutionswelle dauerten bis zum 13. März 1919 an und kosteten mindestens 1.300 Menschen – fast ausschließlich aus der Arbeiterklasse – das Leben.487 In München kam es nach der Ermordung des USPD- Politikers und Ministerpräsidenten Kurt Eisner am 21. Februar 1919 durch einen rechtsradikalen Studenten zur Machtübernahme durch Arbeiterräte und am 7. April 1919 zur Ausrufung einer Räterepublik. Auch hier setzte Gustav Noske auf den massiven Einsatz von schwerbewaffneten Regierungstruppen und Freikorps, die Ende April 1919 zunächst einen Belagerungsring um München bildeten, dann einmarschierten und rasch die chancenlosen Truppen der Räterepublik zerschlugen, bevor auch hier eine mehrtägige Verhaftungs- und Exekutionswelle in der Arbeiterbevölkerung einsetzte, die bis zum 8. Mai 1919 zwischen 600 und 1.000 Menschenleben kostete.488 483 Vgl. Schmidt, Schützen und Dienen, S. 68ff.; Ulrich, Die Revolution, S. 83ff. 484 Vgl. Schumann, Politische Gewalt, S. 45ff. 485 Vgl. Schmidt, Schützen und Dienen, S. 69; Ulrich, Die Revolution, S. 86 f. 486 Vgl. Sturm, Weimarer Republik, S. 17 f. 487 Vgl. Ulrich, Die Revolution, S. 88ff.; Hürten, Bürgerkriege in der Republik, S. 85 f.; Mai, Die Weimarer Republik, S. 24. 488 Vgl. Niedhart, Deutsche Geschichte, S. 37ff.; Ulrich, Die Revolution, S. 92ff.; Hürten, Bürgerkriege in der Republik, S. 86 f.; Mai, Die Weimarer Republik, S. 24. III. Historische Grundlagen 110 Durch die Niederschlagung dieser von der extremen Linken ausgehenden Unruhen, die nach überwiegender Literaturmeinung das Ende der Revolution von 1918/19 markieren, zeigten die junge Republik und insbesondere ihre sozialdemokratisch dominierte Regierung den Willen und die Stärke, das demokratisch-parlamentarische System gegen seine Feinde ‚von links‘ zu verteidigen. Sie zahlte dafür allerdings auch einen hohen ‚Preis‘. Der kompromisslose, auf massive Gewalt setzende Kurs der Regierung bewirkte eine „working-class alienation from those leaders and from the Republic that they had established“489, eine Radikalisierung der extremen Linken und eine Stärkung der Position des monarchistisch-konservativen Militärs und der rechtsradikalen Freikorps.490 Die Folgen dieser Entwicklungen ließen nicht lange auf sich warten. Vor dem Hintergrund des Versailler Friedensvertrages, der von der deutschen Bevölkerung und allen Parteien als illegitim und demütigend empfunden wurde und insbesondere bei der Militärführung wegen der massiven Einschränkungen der militärischen Kapazitäten Deutschlands als inakzeptabel galt, bahnten sich Anfang 1920 die nächsten gewaltsamen Aufstände gegen die Staatsgewalt an.491 Dieses Mal ging die Initiative allerdings vom rechten politischen Lager aus. Den Anfang machte der so genannte ‚Kapp-Lüttwitz-Putsch‘ – ein konterrevolutionärer Militärputsch, dessen Hauptakteure General Walther von Lüttwitz und der rechtsradikale, der antirepublikanischen Nationalen Vereinigung angehörende Politiker Wolfgang Kapp waren. Nach dem kampflosen Einzug einer Militärbrigade unter der Leitung von Walther von Lüttwitz in das Berliner Regierungsviertel am 13. März 1920 und der erklärten Absetzung der aus Berlin nach Stuttgart geflohenen, bisherigen Regierung zeigte sich jedoch rasch, dass die Putschisten auf wenig Unterstützung – insbesondere auch von Seiten des Militärs – hoffen konnten. Der von den linken Parteien ausgerufene Generalstreik sowie die Weigerung der Berliner Ministerialbürokratie, den Anordnungen der Putschisten zu folgen, führten daher bereits am 489 Tobin, Revolution and Alienation: The Foundations of Weimar, S. 166. 490 Vgl. Kolb, Deutschland, S. 30 f.; Hürten, Bürgerkriege in der Republik, S. 87 f.; Mai, Die Weimarer Republik, S. 24ff. 491 Vgl. W. Elz, Versailles und Weimar, in: Aus Politik und Zeitgeschichte, o. Jg. (2008), Nr. 50/51, S. 31ff.; Kluge, Die Weimarer Republik, S. 45ff.; Ulrich, Die Revolution, S. 101ff.; Kolb, Deutschland, S. 35ff.; L. Lüdicke, Die neue Staatenwelt nach 1918, in: Aus Politik und Zeitgeschichte, o. Jg. (2008), Nr. 50/51, S. 26 f. 2. Die deutsche Zwischenkriegszeit und ihre Sicherheitslage 111 17. März 1920 zum Rücktritt und zur Flucht von Wolfgang Kapp und Walther von Lüttwitz und damit zum Scheitern des Staatsstreiches.492 Die eigentliche Gewalt fand allerdings nicht in Berlin, sondern im Ruhrgebiet sowie in den mitteldeutschen Industrierevieren statt, wo sich der als Reaktion auf den ‚Kapp-Lüttwitz-Putsch‘ ausgerufene Generalstreik radikalisierte und es zur Bildung von bewaffneten Einheiten aus der Arbeiterschaft kam. Sowohl die Selbstschutzgruppen der sächsischen und thüringischen Arbeiterschaft als auch die im Ruhrgebiet agierende, so genannte ‚Rote Ruhrarmee‘ konnten sich während des Putsches erfolgreich gegen die anrückenden Freikorps sowie anschließend auch gegen Regierungstruppen durchsetzen, so dass Arbeitervertreter für einige Wochen faktisch über die Industriereviere herrschten.493 Allerdings wiederholten sich dann im April 1920 die Handlungsmuster, die bereits bei den oben dargestellten Arbeiteraufständen im Frühjahr 1919 zu beobachten waren, d. h. schwerbewaffnete, den Arbeitertruppen zahlenmäßig weit überlegene Regierungstruppen und Freikorps schlugen die ‚konter-konterrevolutionären‘ Aufstände mit äußerster Gewalt nieder und begannen dann sowohl im Ruhrgebiet als auch in Mitteldeutschland einen ‚Terrorfeldzug‘ gegen die Arbeiterschaft, dem mindestens 2.000 Menschen zum Opfer fielen und der die politische Radikalisierung weiter vorantrieb.494 Dies galt insbesondere für die Linke, die „mit ihrer Niederlage in einem Meer von Blut [versank], was entsprechende soziale Wunden und politische Gräben hinterließ“495. Die politischen Folgen dieser Ereignisse zeigten sich nicht zuletzt in den Reichstagswahlen am 6. Juni 1920, die mit einem Debakel der Regierungskoalition aus SPD, DDP und Zentrumspartei und massiven Gewinnen der Opposition, insbesondere der nationalkonservativen Deutschnationalen Volkspartei (DNVP), der nationalliberalen Deutschen Volkspartei (DVP) und der USPD endeten, so dass eine bürgerliche Minderheitsregierung aus 492 Vgl. Broué, The German Revolution 1917-1923, S. 349ff.; Mai, Die Weimarer Republik, S. 39 f.; Hürten, Bürgerkriege in der Republik, S. 88ff.; Kluge, Die Weimarer Republik, S. 62ff.; Thoß, Demokratie ohne Demokraten, S. 44 f.; Peukert, Die Weimarer Republik, S. 78 f.; Wirsching, Die Weimarer Republik, S. 12; Ulrich, Die Revolution, S. 116 f.; Sturm, Weimarer Republik, S. 25 f. 493 Vgl. G. Eliasberg, Der Ruhrkrieg von 1920, Bonn 1974, S. 133ff.; Hürten, Bürgerkriege in der Republik, S. 90ff.; Kolb, Deutschland, S. 60 f. 494 Vgl. Schumann, Politische Gewalt, S. 84ff.; Kluge, Die Weimarer Republik, S. 64 f.; Mai, Die Weimarer Republik, S. 41; Sturm, Weimarer Republik, S. 26; Peukert, Die Weimarer Republik, S. 79; Wirsching, Die Weimarer Republik, S. 12; Schmidt, Schützen und Dienen, S. 74 f. 495 Niedhart, Deutsche Geschichte, S. 70. III. Historische Grundlagen 112 DDP, DVP und Zentrumspartei die Macht übernahm. Die Radikalisierung der Linken zeigte sich bald nach der Wahl, als sich im Oktober 1920 die USPD spaltete und der linke Parteiflügel, der etwas mehr als die Hälfte ihrer Mitglieder umfasste, mit der KPD fusionierte, während der rechte Parteiflügel mit der SPD zusammenging. Auf diese Weise verschaffte sich die KPD eine Massenbasis in der deutschen Arbeiterschaft, die ihren Handlungsspielraum deutlich erweiterte und sich in der Folgezeit in Form von Arbeiteraufständen bemerkbar machte.496 Der wohl bedeutendste dieser Aufstände war der ‚Mitteldeutsche Aufstand‘, der von der KPD-Führung „in illusionärer Überschätzung ihres durch den Anschluß des linken USPD-Flügels gewonnenen Aktionspotentials“497 im März 1921 im sächsischen Industrierevier Merseburg-Halle- Mansfeld begonnen wurde. Erneut zeigte sich, dass die Unterstützung für solche revolutionären Bestrebungen in der Arbeiterschaft nicht ausreichte, um die Regierung ernsthaft in Bedrängnis zu bringen. Dem Aufruf der KPD zum Generalstreik im ganzen Reich folgten nur Arbeiter in Teilen des Ruhrgebiets, in Hamburg, in der Lausitz und in Thüringen. Und auch der bewaffnete Aufstand, der am 23. März 1921 begann und sich fast ausschließlich in den Industrierevieren um Halle, Merseburg und Bitterfeld abspielte, wurde innerhalb weniger Tage durch Polizeitruppen gewaltsam niedergeschlagen, wobei es auch hier zu zahlreichen Misshandlungen und rechtswidrigen Tötungen durch die Polizei kam.498 Auch wenn man den Mitteldeutschen Aufstand von 1921 angesichts von ca. 180 Todesopfern und ca. 200.000 Streikenden wohl eher nicht „als revolutionäres Großereignis“499 sehen kann, so belegen die Geschehnisse, „daß die extreme Linke 496 Vgl. Kluge, Die Weimarer Republik, S. 65 f.; Kolb, Deutschland, S. 62 f.; Niedhart, Deutsche Geschichte, S. 70ff.; Thoß, Demokratie ohne Demokraten, S. 48; Ulrich, Die Revolution, S. 117 f. 497 Kolb, Deutschland, S. 70. 498 Vgl. C. Knatz, „Ein Heer im grünen Rock“? Der Mitteldeutsche Aufstand 1921, die preußische Schutzpolizei und die Frage der inneren Sicherheit in der Weimarer Republik, Berlin 2000, S. 88ff.; Kolb, Deutschland, S. 71; H. A. Winkler, Von der Revolution zur Stabilisierung – Arbeiter und Arbeiterbewegung in der Weimarer Republik 1918 bis 1924, Berlin u. a. 1984, S. 516ff.; K. Schwabe, Der Weg der Republik vom Kapp-Putsch 1920 bis zum Scheitern des Kabinetts Müller 1930, in: in: K. D. Bracher, M. Funke, H.-A. Jacobsen [Hrsg.], Die Weimarer Republik 1918-1933 – Politik, Wirtschaft, Gesellschaft, Düsseldorf 1987, S. 99 f.; Schumann, Politische Gewalt, S. 109ff. 499 Vgl. Knatz, „Ein Heer im grünen Rock“?, S. 218ff. (Zitat: S. 220). 2. Die deutsche Zwischenkriegszeit und ihre Sicherheitslage 113 nach wie vor aktionsbereit war“500 und dass „die Stoßkraft der kommunistischen Bewegung keineswegs gebrochen [war]“501. Dies galt allerdings auch für die extreme Rechte, die sich in den Jahren 1921 und 1922 wegen der mittlerweile offiziell aufgelösten Freikorps in ‚Vaterländischen Verbänden‘ oder sonstigen illegalen Geheimbünden neu formierte502 und angesichts der geringen Erfolgsaussichten eines Staatsstreiches zunächst insbesondere in Form von politischen Morden aktiv wurde. Die prominentesten Opfer dieser so genannten ‚Fememorde‘ waren am 9. Juni 1921 Karl Gareis, Fraktionsvorsitzender der USPD im bayerischen Landtag, am 26. August 1921 Matthias Erzberger, Zentrumspolitiker und ehemaliger Reichsfinanzminister, und am 24. Juni 1922 Walther Rathenau, DDP-Politiker, Industrieller und Reichsaußenminister.503 Gerade der letztgenannte Mord, der „die deutsche Öffentlichkeit wie kaum ein zweites Ereignis in der Geschichte der Weimarer Republik [schockierte]“504, verdeutlichte die zunehmende Gefährdung der Republik durch das rechtsextreme politische Lager und führte zu verschiedenen legislativen Initiativen der Regierung, um republikfeindliche Agitation ‚von rechts‘ und die dazugehörigen Gewaltakte effektiver bekämpfen zu können. Das am 18. Juli 1922 verabschiedete Gesetz zum Schutz der Republik richtete sich dann allerdings – vor allem wegen des Widerstands des konservativen Lagers und der weit rechts stehenden bayerischen Regierung – gegen jede Form des Extremismus und erwies sich als wenig wirkungsvoll.505 Das Jahr 1923 gilt in der Geschichtsschreibung als ‚Krisenjahr‘, in dem sich die zahlreichen politischen, ökonomischen und sozialen Probleme Deutschlands „noch einmal potenzierten“506 und „die Weimarer Republik in die gefährlichste außen- und innenpolitische Kraftprobe ein[trat], die sie bis dahin zu bestehen hatte“507. Der Ausgangspunkt hierfür war die Besetzung des Ruhrgebiets durch französische und belgische Truppen am 500 Niedhart, Deutsche Geschichte, S. 75. 501 Kolb, Deutschland, S. 71. 502 Vgl. Bracher, Die Auflösung der Weimarer Republik, S. 116ff. 503 Vgl. Schwabe, Der Weg der Republik, S. 102 f.; Kolb, Deutschland, S. 72 f.; Wirsching, Die Weimarer Republik, S. 12 f.; Kluge, Die Weimarer Republik, S. 67 f.; Sturm, Weimarer Republik, S. 27ff. 504 Schumann, Politische Gewalt, S. 163. 505 Vgl. Niedhart, Deutsche Geschichte, S. 80 f.; Kolb, Deutschland, S. 72 f.; Schwabe, Der Weg der Republik, S. 102; Thoß, Demokratie ohne Demokraten, S. 448 f.; Peukert, Die Weimarer Republik, S. 83. 506 Wirsching, Die Weimarer Republik, S. 13. 507 Schwabe, Der Weg der Republik, S. 104. III. Historische Grundlagen 114 11. Januar 1923 als unmittelbare Reaktion auf einen Rückstand von Sachlieferungen, die Deutschland gemäß dem Versailler Friedensvertrag hätte leisten müssen.508 Die Ursachen für den deutschen Zahlungs- bzw. Leistungsverzug waren vielfältig und reichten von der im Versailler Vertrag festgeschriebenen Abtretung wichtiger Industriereviere an Nachbarstaaten über eine riskante, die Inflation anheizende Finanz- und Währungspolitik des Deutschen Reiches seit 1914 bis hin zu den sehr hohen – aber objektiv betrachtet durchaus zu bewältigenden – Reparationsforderungen der Alliierten und einer generellen Unwilligkeit der deutschen Bevölkerung wie auch ihrer politischen Führer, diese als ungerecht empfundenen Forderungen zu begleichen.509 Der Einmarsch französischer und belgischer Truppen in deutsches Staatsgebiet, der auch von der internationalen Staatengemeinschaft überwiegend als unangemessene, den Frieden in Europa gefährdende Überreaktion Frankreichs gesehen wurde, rief in Deutschland in allen politischen Lagern und Bevölkerungsschichten eine enorme Welle der Empörung hervor, die durch das teilweise äußerst gewaltsame Vorgehen des französischen Militärs noch gesteigert wurde. Die deutsche Regierung rief daraufhin zum passiven Widerstand auf und unterband alle Leistungen an die Besatzungsbehörden. Aus dem rechtsradikalen Milieu kam es auch vereinzelt zu Sabotageakten und Anschlägen gegen Angehörige der Besatzungsmächte. Die Besatzungsmächte reagierten auf diesen passiven und aktiven Widerstand der deutschen Seite mit Beschlagnahmungen, Ausweisungen, Verhaftungen und Gewalt, so dass im so genannten ‚Ruhrkampf‘ bis zum Ende des Jahres 1923 deutlich mehr als 100 Todesopfer zu beklagen waren.510 Angesichts der hohen Kosten des passiven Widerstandes kam es zu einer massiven Kapitalflucht und Hyperinflation, die einerseits zwar Schuldner und insbesondere den Staat entschuldete, die andererseits aber auch breite 508 Vgl. Broué, The German Revolution 1917-1923, S. 685ff.; Niedhart, Deutsche Geschichte, S. 83; Thoß, Demokratie ohne Demokraten, S. 53; Kluge, Die Weimarer Republik, S. 74 f.; Lüdicke, Die neue Staatenwelt nach 1918, S. 30. 509 Vgl. G. D. Feldman, The Great Disorder: Politics, Economics, and Society in the German Inflation 1914-1924, Oxford 1993, S. 25ff. und S. 309ff.; Balderston, Economics and Politics in the Weimar Republic, S. 10ff.; Kluge, Die Weimarer Republik, S. 69ff.; Thoß, Demokratie ohne Demokraten, S. 49ff.; Kolb, Deutschland, S. 63ff.; Peukert, Die Weimarer Republik, S. 62ff.; Sturm, Weimarer Republik, S. 29 f.; C.-L. Holtfrerich, The German Inflation 1914-1923: Causes and Effects in International Perspective, Berlin u. a. 1986, S. 102ff. 510 Vgl. Thoß, Demokratie ohne Demokraten, S. 54 f.; Sturm, Weimarer Republik, S. 29 f.; Niedhart, Deutsche Geschichte, S. 83; Gessner, Die Weimarer Republik, S. 15. 2. Die deutsche Zwischenkriegszeit und ihre Sicherheitslage 115 Bevölkerungsschichten faktisch enteignete und im Zusammenspiel mit der rasant steigenden Arbeitslosigkeit in existenzielle Not brachte.511 Letztlich führte dies dazu, dass nach einem Regierungswechsel und der Bildung einer Großen Koalition aus SPD, DDP, Zentrumspartei und DVP unter dem nationalliberalen Reichskanzler Gustav Stresemann am 26. September 1923 der Abbruch des passiven Widerstands angeordnet werden musste, was einer ‚bedingungslosen Kapitulation‘ Deutschlands gleichkam.512 Die in den folgenden Monaten durchgeführte Währungsreform513 sowie die konkrete Aussicht auf eine Neuregelung der Reparationszahlungen führten zwar zu einer ökonomischen Stabilisierung, gleichwohl waren die psychologischen und emotionalen Folgen dieser erneuten deutschen ‚Kapitulation‘ verheerend. Dies spiegelte sich nicht zuletzt in Aufstands- und Putschversuchen im Herbst 1923 in Bayern, Mitteldeutschland, Hamburg und dem Rheinland wider, die „die Weimarer Republik […] in die schwerste Existenzkrise seit ihrer Gründung“ 514 stürzten.515 Gefahr drohte der Republik zum einen ‚von links‘. Die KPD sah angesichts der instabilen politischen und sozialen Lage in Deutschland den Zeitpunkt für eine revolutionäre Erhebung nach sowjetischem Vorbild gekommen und begann im Oktober 1923 in Thüringen und Sachsen, wo sie mit der SPD über eine Mehrheit in den Landtagen verfügte und entsprechende Regierungsbündnisse einging, mit der Aufstellung von bewaffneten, ‚proletarischen Hundertschaften‘. Durch das entschlossene Einschreiten der Reichsregierung, die am 23. Oktober 1923 Truppen in Sachsen einmarschieren ließ und nicht nur auf die Auflösung der ‚proletarischen Hundertschaften‘, sondern auch auf den Ausschluss der KPD aus den Landesregierungen bestand, wurden diese Konflikte bereits im Ansatz erstickt. Die KPD hatte bereits am 21. Oktober 1923 aufgrund mangelnder Unterstützung von Seiten der mitteldeutschen Arbeiterschaft ihre Aufstandspläne 511 Vgl. Feldman, The Great Disorder, S. 631ff.; L. E. Hill, C. E. Butler, S. A. Lorenzen, Inflation and the Destruction of Democracy: The Case of the Weimar Republic, in: Journal of Economic Issues, 11. Jg. (1977), Nr. 2, S. 299ff.; Balderston, Economics and Politics in the Weimar Republic, S. 34ff.; Gessner, Die Weimarer Republik, S. 38ff.; Sturm, Weimarer Republik, S. 31 f.; Kluge, Die Weimarer Republik, S. 82ff.; Peukert, Die Weimarer Republik, S. 71ff. 512 Vgl. Peukert, Die Weimarer Republik, S. 69ff.; Kolb, Deutschland, S. 75ff.; Schwabe, Der Weg der Republik, S. 106ff.; Thoß, Demokratie ohne Demokraten, S. 55ff.; Kluge, Die Weimarer Republik, S. 75 f. 513 Vgl. Feldman, The Great Disorder, S. 698ff. 514 Schwabe, Der Weg der Republik, S. 112. 515 Vgl. Peukert, Die Weimarer Republik, S. 70 f. und S. 73 f.; Kolb, Deutschland, S. 76 f.; Thoß, Demokratie ohne Demokraten, S. 57. III. Historische Grundlagen 116 abgesagt, so dass es lediglich in Hamburg – vermutlich aufgrund eines Fehlers bei der Nachrichtenübermittlung – am 23. Oktober 1923 zu einem kommunistischen Aufstand kam, der auf wenig Unterstützung in der Bevölkerung stieß, mindestens 40 Menschen das Leben kostete und bereits am 25. Oktober 1923 von der Polizei gewaltsam niedergeschlagen worden war.516 Für die KPD hatte dieses vergleichsweise unspektakuläre Scheitern des ‚deutschen Oktobers‘ durchaus gravierende negative Konsequenzen, da sie an Glaubwürdigkeit und damit massiv an Unterstützung in der deutschen Arbeiterschaft verlor, so dass sie in den nächsten Jahren „keine wirklich entscheidende Kraft innerhalb der Arbeiterbewegung oder in der grö- ßeren politischen Arena dar[stellte]“517. Eric D. Weitz spricht in diesem Zusammenhang sogar von einem „world-shattering event. It marked not only the end of any hopes for a socialist Germany in this period. It also meant that the Bolshevik Revolution would remain isolated.“518 Gefahr drohte der Republik zum anderen aber auch ‚von rechts‘. Das Epizentrum der rechtsradikalen Aktivitäten gegen die Republik lag in Bayern, wo die rechtsstehende bayerische Regierung bereits am 26. September 1923 und damit parallel zum Abbruch des ‚Ruhrkampfes‘ den Ausnahmezustand verhängte – offiziell begründet mit einem bevorstehenden Putschversuch, vermutlich aber mit dem Ziel der reichsweiten Solidarisierung aller rechtsgerichteten Kräfte. Den daraufhin von Gustav Stresemann ausgerufenen, reichsweiten Ausnahmezustand erkannte die bayerische Regierung nicht an, was einen Verfassungsbruch darstellte. Zudem verweigerten in Bayern stationierte Reichswehrtruppen am 19. Oktober 1923 die Ausführung von Befehlen der Zentralregierung.519 Erschwerend kam hinzu, dass General Hans von Seeckt als Chef der Heeresleitung der Reichswehr 516 Vgl. Broué, The German Revolution 1917-1923, S. 791ff.; Kolb, Deutschland, S. 77 f.; Thoß, Demokratie ohne Demokraten, S. 59 f.; Winkler, Von der Revolution zur Stabilisierung, S. 621ff.; Kluge, Die Weimarer Republik, S. 78 f.; Peukert, Die Weimarer Republik, S. 81 f. Knatz geht sogar von 78 Toten aus; vgl. C. Knatz, Polizei in der Weimarer Republik – Orientierungssuche zwischen Tradition und Modernisierung, in: H.-J. Lange [Hrsg.], Die Polizei der Gesellschaft – Zur Soziologie der Inneren Sicherheit, Opladen 2003, S. 47. 517 Kolb, Deutschland, S. 80. 518 E. D. Weitz, Foreword to the English Edition, in: P. Broué, The German Revolution 1917-1923, Leiden 2005 (Erstveröffentlichung: 1971), S. xii. 519 Vgl. Niedhart, Deutsche Geschichte, S. 86 f.; Sturm, Weimarer Republik, S. 33; Kolb, Deutschland, S. 79 f. 2. Die deutsche Zwischenkriegszeit und ihre Sicherheitslage 117 in dieser Zeit offenkundig einen Militärputsch in Erwägung zog.520 Am 8. November 1923 unternahm dann der Führer der rechtsradikalen Nationalsozialistischen Deutschen Arbeiterpartei (NSDAP), Adolf Hitler, in München einen dilettantisch geplanten Putschversuch gegen die Reichsregierung, der bereits einen Tag später von der bayerischen Polizei gewaltsam niedergeschlagen wurde und neben 4 Polizisten auch 16 Putschisten das Leben kostete.521 Am gleichen Tag wurde Hans von Seeckt vom Reichpräsidenten Friedrich Ebert mit der Abwehr der rechts- und linksradikalen Angriffe auf die Republik beauftragt und für die Dauer des Ausnahmenzustandes zur höchsten Exekutivinstanz im Reich ernannt, der diese Aufgabe äußerst loyal erfüllte, von seinen Putschabsichten Abstand nahm, die NSDAP, die Deutschvölkische Freiheitspartei (DVFP) sowie auch die KPD verbot und seine Sondervollmachten nach Beendigung der Krise im Februar 1924 wieder an den Reichspräsidenten zurückgab.522 Schließlich kam es im Oktober und November 1923 im Rheinland sowie in der bayerischen Pfalz und in Rheinhessen zu Unabhängigkeitserklärungen und der Erstürmung von Rathäusern durch von Frankreich und Belgien unterstützte separatistische Bewegungen, gegen die sich die deutsche Regierung nicht wehren konnte, da sie keine Truppen in diese Gebiete entsenden durfte. Diese Bestrebungen brachen allerdings auch ohne den Einsatz des Militärs rasch in sich zusammen, da sie nicht nur kaum Rückhalt in der Bevölkerung hatten, sondern zudem auch bald auf internationalen Druck hin die französische Unterstützung aus Frankreich verloren.523 Nach der Überwindung dieser innen- und außenpolitischen Konflikte trat die Weimarer Republik in eine deutlich ‚ruhigere‘ Phase, was vor allem auf das Ende der Hyperinflation und die damit verbundene Normalisierung der Lebens- und Arbeitsbedingungen zurückzuführen war.524 Die 520 Vgl. Schwabe, Der Weg der Republik, S. 112ff.; Niedhart, Deutsche Geschichte, S. 87; Kolb, Deutschland, S. 78. 521 Vgl. H. Mommsen, Adolf Hitler und der 9. November 1923, in: J. Willms [Hrsg.], Der 9. November – Fünf Essays zur deutschen Geschichte, 2. Aufl., München 1995, S. 33ff.; W. Ziegler, Hitlerputsch, 8./9. November 1923, in: Historisches Lexikon Bayerns, München 2013, http://www.historisches-lexikonbayerns.de/artikel/artikel_44511 (Zugriff: 12.2.2018); Sturm, Weimarer Republik, S. 34 f. 522 Vgl. Thoß, Demokratie ohne Demokraten, S. 65; Wirsching, Die Weimarer Republik, S. 15. 523 Vgl. Winkler, Von der Revolution zur Stabilisierung, S. 650ff.; Schwabe, Der Weg der Republik, S. 116 f.; Niedhart, Deutsche Geschichte, S. 88 f. 524 Vgl. Wirsching, Die Weimarer Republik, S. 15; Schwabe, Der Weg der Republik, S. 117 f. III. Historische Grundlagen 118 von Gustav Stresemann geführte Regierung konnte dies allerdings nicht mehr retten. Sie wurde 23. November 1923 per Misstrauensvotum gestürzt und durch eine bürgerliche Minderheitsregierung unter dem Zentrumspolitiker Wilhelm Marx abgelöst, der Gustav Stresemann als Außenminister angehörte.525 Zudem war die Stabilisierung nicht etwa gleichbedeutend mit der nachhaltigen Beseitigung der existenziellen Bedrohungsszenarien für den jungen Weimarer Staat. Zweifelsohne war die Regierung im Jahr 1923 durchaus erfolgreich bei der Währungsreform, der Inflationsbekämpfung und der Entschärfung der Reparationsfrage, allerdings galt dies nicht für den Kampf gegen die militanten – und dabei vor allem die rechtsextremen – Gegner der republikanischen Staatsordnung, die „in den Jahren zwischen 1918/19 und 1923 nur eine scheinbare Niederlage erlitten“ und „als gefährliche Unterströmungen auch nach 1923 erhalten“ blieben.526 Relative Stabilisierung der Republik (1924-29) Die 1924 erstaunlich rasch einsetzende relative Stabilisierung und dann auch Verbesserung der politischen, ökonomischen und sozialen Rahmenbedingungen in Deutschland war nach Eberhard Kolb „[e]inem günstigen Zusammentreffen und Zusammenwirken von inneren und äußeren Bestimmungsfaktoren […] zu verdanken“527. Auf dem Gebiet der Außenpolitik spielte dabei zunächst der seit dem Herbst 1923 mit den Alliierten verhandelte und im September 1924 in Kraft getretene ‚Dawes-Plan‘, der für die deutsche Seite eine erhebliche Erleichterung der Reparationszahlungskonditionen bedeutete und den Abzug der französischen und belgischen Besatzungstruppen aus dem Ruhrgebiet zur Folge hatte, eine wesentliche Rolle.528 Ein Jahr später folgte dann die als ‚Verträge von Locarno‘ bezeichnete völkerrechtliche Vereinbarung zwischen Deutschland, Frankreich und Belgien, die den territorialen Status quo an der deutschen Westgrenze sicherte, wobei Großbritannien und b) 525 Vgl. Thoß, Demokratie ohne Demokraten, S. 66; Sturm, Weimarer Republik, S. 35. 526 Vgl. Niedhart, Deutsche Geschichte, S. 73 f. (Zitate: S. 74 und S. 73); Peukert, Die Weimarer Republik, S. 85 f. 527 Kolb, Deutschland, S. 85. 528 Vgl. H. Coing, Dawes-Plan, in: H.-J. Schlochauer, H. Krüger, H. Mosler, U. Scheuner [Hrsg.], Wörterbuch des Völkerrechts – Bd. 1: Aachener Kongress – Hussar-Fall, 2. Aufl., Berlin 1960, S. 314ff.; D. Felix, Reparations Reconsidered with a Vengeance, in: Central European History, 4. Jg. (1971), Nr. 2, S. 171ff. 2. Die deutsche Zwischenkriegszeit und ihre Sicherheitslage 119 Italien als Garantiemächte fungierten. Dies führte zu einer deutlichen Stärkung der deutschen Stellung in der internationalen Staatengemeinschaft, was sich nicht zuletzt in der Aufnahme Deutschlands in den Völkerbund am 10. September 1926 widerspiegelte.529 Eine weitere Normalisierung der internationalen Beziehungen ergab sich schließlich durch den ‚Young- Plan‘, der den ‚Dawes-Plan‘ zum 1. September 1929 ablöste und nicht nur eine weitere Verbesserung der Reparationszahlungskonditionen, sondern zudem den vorzeitigen Abzug der alliierten Truppen aus dem Rheinland bedeutete. Trotz ihrer objektiven Vorteile stieß diese Vereinbarung bei einem erheblichen Teil der Bevölkerung und insbesondere bei den nationalistischen Rechten gleichwohl auf schärfste Ablehnung. Dies veranschaulicht zum einen die begrenzte innenpolitische Wirkung dieser außenpolitischen Erfolge und zum anderen die abnehmende Akzeptanz einer auf internationale Verständigung abzielenden Außenpolitik in der deutschen Bevölkerung.530 Aus innenpolitischer Perspektive ist festzuhalten, dass das parlamentarische System der Weimarer Republik zwischen 1924 und 1929 weiterhin äu- ßerst instabil und durch zahlreiche Regierungswechsel geprägt war, die Klaus Schwabe recht anschaulich als „Koalitionskarussel“ bezeichnet.531 So gab es in diesen sechs Jahren insgesamt sieben Regierungswechsel, bei denen viermal der Zentrumspolitiker Wilhelm Marx, zweimal der Parteilose Hans Luther und einmal der Sozialdemokrat Hermann Müller in verschiedenen Regierungskoalitionen, bei denen „tiefgreifende weltanschauliche, soziale und regionale Spannungen eher durch Koalitionsarithmetik als durch gemeinsame programmatische Ziele überdeckt und damit keinesfalls gelöst wurden“, als Reichskanzler fungierten.532 Ursächlich hierfür waren nicht nur die inkompatiblen innen- wie außenpolitischen Ziele der größeren Parteien, sondern auch ihre starke Milieugebundenheit sowie innerparteiliche Spannungen, die eine stetige und verlässliche politische Arbeit durch die Regierung erschwerten.533 In diesem Kontext ist auch der 529 Vgl. Peukert, Die Weimarer Republik, S. 196ff.; Sturm, Weimarer Republik, S. 36 f.; Niedhart, Deutsche Geschichte, S. 100ff. 530 Vgl. P. Heyde, Das Ende der Reparationen – Deutschland, Frankreich und der Young-Plan 1929-1932, Paderborn u. a. 1998, S. 35ff.; Kolb, Deutschland, S. 106ff. und S. 173ff.; Kluge, Die Weimarer Republik, S. 333ff. 531 Vgl. Schwabe, Der Weg der Republik, S. 119ff. (Zitat: S. 123). 532 Vgl. Peukert, Die Weimarer Republik, S. 205ff. (Zitat: S. 209). Vgl. auch die Übersicht bei Niedhart, Deutsche Geschichte, S. 192ff. 533 Vgl. Bracher, Die Auflösung der Weimarer Republik, S. 58 ff.; Kolb, Deutschland, S. 110ff.; Wirsching, Die Weimarer Republik, S. 17ff. III. Historische Grundlagen 120 Tod des stets überparteilich agierenden und damit stabilisierend wirkenden Reichspräsidenten Friedrich Ebert am 28. Februar 1925 und die anschließende Wahl des kaiserlichen Generalfeldmarschalls Paul von Hindenburgs zu seinem Nachfolger zu berücksichtigen, die Gunter W. Remmling als Beginn eines „internal political disasters“534 bezeichnet. Mit Paul von Hindenburg wurde ein Vertreter des wilhelminisch-monarchistischen Deutschlands, dem politischer Pluralismus fremd war, der das Reichspräsidialamt systematisch als konkurrierendes Machtzentrum zum Reichstag ausbaute und der von Anfang an versuchte, „die politische Achse der Republik nach rechts zu verschieben“, zum Staatsoberhaupt der Weimarer Republik gewählt, was „zweifellos ein schwerer Rückschlag für die demokratische Legitimation der Republik“ war und damit ein weiteres destabilisierendes Element im parlamentarischen System darstellte.535 Durchaus nachvollziehbar ist die Stabilitätsthese hingegen im Hinblick auf die Sicherheitslage der Weimarer Republik, die sich durch einen Rückgang der Kriminalität536, der politischen Gewalt und insbesondere der Häufigkeit von größeren, gewaltsamen Unruhen, Aufständen oder Putschversuchen in den Jahren zwischen 1924 und 1929 auszeichnete.537 Gleichwohl darf diese insgesamt positive Entwicklung nicht darüber hinweg täuschen, dass „die Kontinuität der Gewalt im kleinen aber keinesfalls abriß“.538 Im Allgemeinen handelte es sich dabei um kleinere Auseinandersetzungen, bei denen die Beteiligten keine schwereren Verletzungen davontrugen, allerdings gab es durchaus auch immer wieder vereinzelte Fälle von tödlicher Gewalt, an denen oftmals auch die Polizei beteiligt war. So kam es z. B. am so genannten ‚Deutschen Tag‘ in Halle am 11. Mai 1924 zu einer Massenkundgebung der radikalen Rechten mit ca. 100.000 Teilnehmern und einem Gegenaufmarsch der radikalen Linken mit ca. 10.000 Teilnehmern. Dies mündete schließlich in eine gewaltsame Auseinander- 534 Remmling, Prologue: Weimar Society in Retrospect, S. 9. 535 Vgl. Peukert, Die Weimarer Republik, S. 210ff. (Zitate: S. 213 und S. 212); Bracher, Die Auflösung der Weimarer Republik, S. 43ff.; Thoß, Demokratie ohne Demokraten, S. 75ff.; Kolb, Deutschland, S. 121ff.; Niedhart, Deutsche Geschichte, S. 198 f und S. 114ff.; Schwabe, Der Weg der Republik, S. 121 f.; Kluge, Die Weimarer Republik, S. 109ff.; Sturm, Weimarer Republik, S. 45ff. 536 Vgl. R. Bessel, Militarisierung und Modernisierung – Polizeiliches Handeln in der Weimarer Republik, in: A. Lüdtke [Hrsg.], »Sicherheit« und »Wohlfahrt« – Polizei, Gesellschaft und Herrschaft im 19. und 20. Jahrhundert, Frankfurt a. M. 1992, S. 339 f. 537 Vgl. Schumann, Politische Gewalt, S. 203 und S. 228; Mai, Die Weimarer Republik, S. 54; Niedhart, Deutsche Geschichte, S. 114; Kolb, Deutschland, S. 109. 538 Schumann, Politische Gewalt, S. 203. 2. Die deutsche Zwischenkriegszeit und ihre Sicherheitslage 121 setzung zwischen der Polizei und den Kommunisten, bei der jeweils ca. 4 Tote auf beiden Seiten zu beklagen waren.539 Und ein Jahr später kam es in dieser Stadt während einer Kundgebung der KPD erneut zu Auseinandersetzungen mit der Polizei, die insgesamt neun Todesopfer auf Seiten der Versammlungsteilnehmer forderte.540 Allerdings waren diese Vorfälle untypisch für diese Zeit. Die meisten dieser Konflikte verliefen weitgehend gewaltlos.541 Äußerst folgenschwer für die innere Sicherheit war hingegen eine andere Entwicklung, nämlich die Neugründung und der Ausbau von mehreren, paramilitärisch organisierten Verbänden sowohl im linken wie im rechten politischen Spektrum in den Jahren ab 1924. So bauten der ‚Stahlhelm-Frontsoldatenbund‘ als paramilitärische Organisation der DNVP sowie zunehmend auch die ‚Sturmabteilung‘ (SA) und die ‚Schutz-Staffel‘ (SS) als paramilitärische Organisationen der NSDAP ihre Strukturen deutschlandweit aus und erhöhten ihre Mitgliederzahlen deutlich, während auf der Gegenseite mit dem SPD-nahen ‚Reichsbanner Schwarz-Rot- Gold‘ und dem KPD-nahen ‚Roten Frontkämpferbund‘ (RFB) ebenfalls paramilitärische, gewaltbereite Organisationen entstanden.542 Auch wenn diese oftmals als ‚Kampfverbände‘ bezeichneten Organisationen zunächst nur für den Schutz von politischen Versammlungen sorgten, so waren sie aber dennoch ein deutlicher Hinweis darauf, dass weite Teile der Gesellschaft das Vertrauen in die demokratisch-parlamentarische Ordnung verloren hatten und den Einsatz von Gewalt zur Erreichung von politischen Zielen akzeptierten.543 Diese Gewalt richtete sich allerdings zunächst weniger gegen den Staat oder die Polizei, sondern eher gegen die ‚Kampfverbände‘ des politischen Gegners, wobei es in der Regel darum ging, „Präsenz zu zeigen, öffentliches Terrain zu behaupten oder erst zu erkämpfen. Die Grenze zum massiven, potentiell tödlichen Einsatz von Gewalt wurde nur selten überschritten.“544 Gleichwohl gab es dabei von Anfang an auch Ausnahmen wie den Tod eines jungen ‚Stahlhelmers‘ am 22. Dezember 1926, der von Mitgliedern der 539 Vgl. Schumann, Politische Gewalt, S. 203ff., insb. S. 207 f. 540 Vgl. Schumann, Politische Gewalt, S. 230ff. 541 Vgl. Schumann, Politische Gewalt, S. 229 und S. 233. 542 Vgl. Bracher, Die Auflösung der Weimarer Republik, S. 121ff. und S. 129ff.; Schumann, Politische Gewalt, S. 210ff.; Kluge, Die Weimarer Republik, S. 225ff. 543 Vgl. Mai, Die Weimarer Republik, S. 54. 544 Schumann, Politische Gewalt, S. 235. III. Historische Grundlagen 122 Kommunistischen Jugend in Halle so schwer misshandelt wurde, dass er wenig später verstarb.545 Ab 1927 intensivierten sich die ‚blutigen‘, teilweise auch mit Todesopfern verbundenen Zusammenstöße zwischen rechten und linken Wehrverbänden, in die zwangsläufig auch die Polizei einbezogen wurde, und überschatteten den politischen Alltag insbesondere in Berlin, aber auch in anderen Städten wie Leipzig und Hamburg.546 Ihren vorläufigen Höhepunkt erreichten die gewaltsamen Auseinandersetzungen dann im so genannten ‚Blutmai‘ des Jahres 1929 in Berlin.547 Vorausgegangen war die Entscheidung des Berliner Polizeipräsidenten am 13. Dezember 1928, nach einer Reihe von gewaltsamen Konflikten zwischen linken und rechten Gruppierungen mit insgesamt vier Todesopfern alle Versammlungen unter freiem Himmel zu verbieten und dieses Verbot dauerhaft aufrechtzuerhalten.548 Die von der KPD dennoch am 1. Mai 1929 in der Hauptstadt organisierten, traditionellen Demonstrationen und Kundgebungen führten erwartungsgemäß zu zahlreichen Zusammenstößen mit der Polizei, in deren Verlauf rasch mehrere Todesopfer auf Seiten der Demonstranten zu verzeichnen waren. In den folgenden drei Tagen kam es dann vor allem in den Arbeitervierteln Neukölln und Wedding zu massiven Straßenschlachten und bürgerkriegsähnlichen Zuständen, die mit 32 Toten – unter denen sich kein Polizist, aber einige unbeteiligte Passanten befanden – und ca. 200 Verletzten endeten.549 Diese Ereignisse verdeutlichen, dass die Jahre 1924 bis 1929 zwar auch sicherheitspolitisch eine Phase der relativen Stabilität mit deutlich weniger Gewaltereignissen, Opfern und Tätern waren als die turbulenten Anfangsjahre der Republik bis 1923 und die noch folgenden Krisenjahre ab 1930 – aber eben keinesfalls eine ‚friedliche‘ Phase. Vielmehr stellt Dirk Schumann in Bezug auf die Kontinuität der linken und rechten politischen Gewalt und ihre Präsenz im politischen und gesellschaftlichen Alltag in diesen Jahren treffend fest: 545 Vgl. Schumann, Politische Gewalt, S. 235. 546 Vgl. Kluge, Die Weimarer Republik, S. 228; Liang, Die Berliner Polizei, S. 1ff. 547 Vgl. Bessel, Policing, S. 201 f.; T. Kurz, Blutmai: Sozialdemokraten und Kommunisten im Brennpunkt der Berliner Ereignisse von 1929, Bonn 1988, S. 27ff.; Knatz, Polizei in der Weimarer Republik, S. 47 f.; Liang, Die Berliner Polizei, S. 120ff.; Leßmann-Faust, Die Preußische Schutzpolizei, S. 230ff. 548 Vgl. Niedhart, Deutsche Geschichte, S. 117; Leßmann-Faust, Die Preußische Schutzpolizei, S. 232. 549 Vgl. Leßmann-Faust, Die Preußische Schutzpolizei, S. 236. 2. Die deutsche Zwischenkriegszeit und ihre Sicherheitslage 123 „Die politische Gewalt war zu einem ubiquitären Phänomen geworden, in dem sich charakteristische Merkmale der politischen Kultur niederschlugen.“550 Abschließend ist noch auf die wirtschaftliche und sozialpolitische Stabilität zwischen 1924 und 1929 einzugehen. Dabei ist zunächst festzustellen, dass die weitverbreitete Vorstellung der ‚Goldenen Zwanziger‘ als einer Phase der wirtschaftlichen Prosperität relativiert werden muss. So zeichneten sich diese Jahre zwar durchaus durch wirtschaftliches Wachstum aus, was gerade im Vergleich zur hyperinflationären Phase bis 1923 sowie zur Weltwirtschaftskrise ab 1930 eindeutig positiv zu bewerten ist, allerdings war dieses Wachstum im internationalen Vergleich eher unterdurchschnittlich ausgeprägt und sektoral sehr ungleichmäßig verteilt. Zudem waren die Staats- und insbesondere die Auslandsverschuldung sowie die Arbeitslosigkeit in Deutschland relativ hoch, während die Arbeitsproduktivität in wichtigen industriellen Branchen im Verhältnis zum Lohnniveau und im Vergleich zu anderen Industrienationen wie Großbritannien oder den USA eher niedrig war.551 Dementsprechend erscheint es aus ökonomischer Perspektive angebracht, in Bezug auf diese Phase der Weimarer Republik von einer wirtschaftlichen „Scheinblüte“552 oder sogar von einer „kranken[n] Wirtschaft“553 auszugehen. Noch schwächer fällt die Bilanz dieser Jahre im Bereich der Sozialbeziehungen aus, der sich durch eine stetige Verschärfung der Konflikte zwi- 550 Schumann, Politische Gewalt, S. 228. 551 Vgl. D. Petzina, Problems in the Social and Economic Development of the Weimar Republic, in: M. N. Dobkowski, I. Wallimann [Hrsg.], Towards the Holocaust: the social and economic collapse of the Weimar Republic, Westport u. a. 1983, S. 37ff. und insb. S. 42; D. Petzina, Die deutsche Wirtschaft in der Zwischenkriegszeit, Wiesbaden 1977, S. 11ff. und S. 92ff.; K. Borchardt, Zwangslagen und Handlungsspielräume in der großen Wirtschaftskrise der frühen dreißiger Jahre, in: Jahrbuch der Bayerischen Akademie der Wissenschaften, o. Jg. (1979), S. 85ff.; K. Borchardt, Wirtschaftliche Ursachen des Scheiterns der Weimarer Republik, in: K.-D. Erdmann, H. Schulze, [Hrsg.], Weimar – Selbstpreisgabe einer Demokratie, Düsseldorf 1980, S. 211ff.; Wirsching, Die Weimarer Republik, S. 69ff.; Sturm, Weimarer Republik, S. 38 f.; Kluge, Die Weimarer Republik, S. 113ff.; Peukert, Die Weimarer Republik, S. 111ff.; Schwabe, Der Weg der Republik, S. 127. 552 Kluge, Die Weimarer Republik, S. 113. 553 Peukert, Die Weimarer Republik, S. 122. III. Historische Grundlagen 124 schen Arbeitnehmern und Arbeitgebern auszeichnete.554 Waren die ersten Jahre der Weimarer Republik noch durch das Konzept der Sozialpartnerschaft, das sich beispielsweise im bereits oben angesprochenen ‚Stinnes- Legien-Pakt‘ vom 15. November 1918 widerspiegelte555, und einem erheblichen Ausbau der Sozialstaates geprägt556, so versuchten die Arbeitgeber – und hier vor allem die Schwerindustrie – spätestens ab 1924 angesichts der nun nicht mehr bestehenden akuten Gefahr einer sozialistischen Revolution die sozialpolitischen Errungenschaften der Arbeiterschaft zu korrigieren, indem sie z. B. die Tarifhoheit der Gewerkschaften in Frage stellten und längere Arbeitszeiten bzw. effektive Lohnkürzungen forderten. Dies mochte zwar möglicherweise ökonomisch rational sein, es führte aber erwartungsgemäß zu einer Vielzahl von Arbeitskämpfen und staatlichen Zwangsschlichtungen. Hinzu kamen Forderungen der Unternehmerseite nach einem generellen Rückbau des Sozialversicherungssystems und insbesondere der seit 1927 bestehenden Arbeitslosenversicherung, die für die Arbeitnehmerseite inakzeptabel waren. Diese „ständige Verschärfung der sozialpolitischen Konflikte während jener Jahre wirkte ohne Zweifel destabilisierend auf das soziale wie auf das politische System“557. Zusammenfassend lässt sich folglich festhalten, dass die als Phase der relativen Stabilisierung bezeichneten Jahre zwischen 1924 und 1929 im Vergleich zu den Jahren 1918 bis 1923 zwar in der Tat eine deutliche Verstetigung der politischen Verhältnisse und auch eine unbestreitbare Verbesserung der Lebensbedingungen in der Weimarer Republik bedeuteten, dass eine umfassende und nachhaltige Konsolidierung der politischen, wirtschaftlichen und sozialen Systeme aber nicht stattfand. Vielmehr deuten die oben erörterte, zahlreichen, weiterhin bestehenden und tendenziell eher zunehmenden gesellschaftlichen Konfliktfelder darauf hin, dass „sich jenes Widerspruchspotential, an dem die Republik 1930 bis 1933 scheitern 554 Vgl. Bracher, Die Auflösung der Weimarer Republik, S. 179ff.; Kolb, Deutschland, S. 130ff.; Peukert, Die Weimarer Republik, S. 129ff.; Thoß, Demokratie ohne Demokraten, S. 87ff. 555 Vgl. Feldman, Das deutsche Unternehmertum zwischen Krieg und Revolution, S. 100ff.; V. Hentschel, Die Sozialpolitik in der Weimarer Republik, in: K.-D. Bracher, M. Funke, H.-A. Jacobsen [Hrsg.], Die Weimarer Republik 1918-1933 – Politik, Wirtschaft, Gesellschaft, Düsseldorf 1987, S. 199ff. 556 Vgl. z. B. Peukert, Die Weimarer Republik, S. 133ff.; Hentschel, Die Sozialpolitik in der Weimarer Republik, S. 207ff. sowie die Übersicht über die sozialpolitischen Errungenschaften in der Weimarer Republik bei Sturm, Weimarer Republik, S. 44. 557 Kolb, Deutschland, S. 130. 2. Die deutsche Zwischenkriegszeit und ihre Sicherheitslage 125 sollte, ausgerechnet in den Jahren der relativen Stabilisierung akkumulierte“558. Späte Krisenjahre und Untergang der Republik (1930-32) Als ‚Anfang vom Ende‘ der Weimarer Republik gilt üblicherweise das Scheitern der Großen Koalition unter dem sozialdemokratischen Reichskanzler Hermann Müller am 27. März 1930, das den Übergang in eine „Ära der Präsidialkabinette“559 markierte und daher aus einer politischen Perspektive sicherlich zu Recht „den entscheidenden inneren Wendepunkt in der Entwicklung der Republik“ darstellte.560 Auch wenn die Ursache für den Bruch der Großen Koalition vordergründig in einem Streit um die Höhe der Arbeitslosenversicherung zu liegen schien, lässt sich aus heutiger Sicht mit Gewissheit feststellen, dass es sich um einen von Reichpräsident Paul von Hindenburg und seiner ‚Kamarilla‘ – d. h. seines u. a. den Ex-General und Reichswehrminister Wilhelm Groener, den Generalmajor Kurt von Schleicher und den Zentrumspolitiker Franz von Papen umfassenden Beraterstabs – seit längerem geplanten Versuch handelte, die Weimarer Verfassung und damit auch die politischen und gesellschaftlichen Verhältnisse grundlegend nach ihren monarchistisch-konservativen Vorstellungen umzugestalten.561 Die neu gebildete Mitte-Rechts-Regierung unter dem am 30. März 1930 vom Reichpräsidenten zum Reichskanzler ernannten Zentrumspolitiker Heinrich Brüning verfügte über keine parlamentarische Mehrheit und regierte auf der Grundlage von Notverordnungen, die vom Reichpräsidenten bei Bedarf erlassen wurden, sowie von ebenfalls vom Reichspräsidenten veranlassten Reichstagsauflösungen, bei denen die Regierung bis zur Neuwahl noch 60 Tage im Amt blieb und weiter regieren konnte. Da der Reichspräsident gemäß der Weimarer Verfassung den Reichskanzler frei bestimmen konnte, hatten aber auch Neuwahlen nur eine begrenzte Auswirkung auf die Regierungsbildung, so dass man durchc) 558 Peukert, Die Weimarer Republik, S. 204. 559 Thoß, Demokratie ohne Demokraten, S. 125. 560 Kolb, Deutschland, S. 136. 561 Vgl. Kolb, Deutschland, S. 189ff.; Thoß, Demokratie ohne Demokraten, S. 125ff.; Niedhart, Deutsche Geschichte, S. 121ff.; M. Funke, Republik im Untergang – Die Zerstörung des Parlamentarismus als Vorbereitung der Diktatur, in: K.-D. Bracher, M. Funke, H.-A. Jacobsen [Hrsg.], Die Weimarer Republik 1918-1933 – Politik, Wirtschaft, Gesellschaft, Düsseldorf 1987, S. 506ff.; Sturm, Weimarer Republik, S. 55 f.; Mai, Die Weimarer Republik, S. 91. III. Historische Grundlagen 126 aus von einer faktischen Entmachtung des Parlaments sprechen kann.562 Dass unter diesen Bedingungen die in der Weimarer Republik ohnehin nie besonders hohe gesellschaftliche Akzeptanz des parlamentarischen Systems weiter in Mitleidenschaft gezogen und antidemokratische Tendenzen befördert wurden, erscheint naheliegend. Einen entscheidenden Beitrag zum Scheitern der Weimarer Republik leistete aber auch die spätestens mit dem Börsencrash in New York am 24. Oktober 1929 virulent gewordene Weltwirtschaftskrise, die insbesondere auf weltweite industrielle sowie landwirtschaftliche Überkapazitäten sowie auf eine Spekulationsblase auf den internationalen Aktienmärkten zurückzuführen war und die einen massiven weltweiten Konjunktureinbruch einhergehend mit Deflation, Insolvenzen, massiver Arbeitslosigkeit und sozialem Elend verursachte.563 In der Weimarer Republik, die vor allem in Bezug auf die Arbeitslosigkeit564 zu den am schwersten von dieser globalen Wirtschafts- und Finanzkrise getroffenen Ländern gehörte565, verstärkte diese Rezession die sozialen Konflikte, was wiederum eine weitere politische Radikalisierung zur Folge hatte. Anders als in den meisten anderen, ebenfalls von der Weltwirtschaftskrise betroffenen Ländern wurde diese in Deutschland trotz ihres ökonomischen Charakters vor allem als „Katalysator für den Bruch mit einem politischen System, das seine Legitimation bereits verloren hatte […]“566, und damit als politische Erfahrung wahrgenommen. Insofern stellte die Weltwirtschaftskrise eine zentrale und direkte Ursache für den nun einsetzenden „Sturm auf die Republik“567 durch die antidemokratisch-nationalistische Rechte und insbesondere durch Adolf Hitlers NSDAP dar. Dies zeigte sich erstmals in den Reichstagswahlen vom 14. September 1930, die aufgrund der ersten Reichstagsauflösung unter dem Präsidialregime angesetzt wurden. Bei diesen Wahlen konnten sowohl die rechts- wie auch die linksradikalen Parteien massive Stimmengewinne verzeichnen 562 Zur Funktionsweise dieser Präsidialregime vgl. z. B. die Grafik bei Sturm, Weimarer Republik, S. 57. 563 Vgl. N. Ferguson, The Ascent of Money – A Financial History of the World, London u. a. 2009, S. 158ff.; C. P. Kindleberger, R. Z. Aliber, Manias, Panics, and Crashes: A History of Financial Crises, 6. Aufl., Houndmills u. a. 2011, S. 78ff. 564 Vgl. D. Petzina, Problems in the Social and Economic Development of the Weimar Republic, 44ff. 565 Vgl. Kluge, Die Weimarer Republik, S. 306ff. 566 Peukert, Die Weimarer Republik, S. 243. 567 Kolb, Deutschland, S. 161. 2. Die deutsche Zwischenkriegszeit und ihre Sicherheitslage 127 und die NSDAP ihren Stimmenanteil im Vergleich zu den letzten Wahlen im Jahr 1928 fast verneunfachen, so dass sie mit 18,3% zweitstärkste Partei nach der SPD (24,5%) und vor der KPD (13,1%) wurde.568 Dass keine dieser drei Parteien sich in der erneut von Heinrich Brüning gebildeten Regierung wiederfand, unterstreicht den antidemokratischen Charakter der Präsidialkabinette unter Reichspräsident Paul von Hindenburg. Um ein weiteres Anwachsen der Wählerschaft der NSDAP zu verhindern, entschied sich die SPD für eine Tolerierung der neuen Regierung, was sich jedoch angesichts der alles andere als arbeiterfreundlichen Politik Henrich Brünings äußerst negativ auf die Glaubwürdigkeit der SPD auswirkte.569 Diese Tolerierungspolitik der SPD schloss sogar die Wiederwahl Paul von Hindenburgs, dessen Ablehnung und Verachtung der Sozialdemokratie kein Geheimnis war, zum Reichspräsidenten am 10. April 1932 ein, wobei dies angesichts von Adolf Hitler als alternativen Präsidentschaftskandidaten zumindest nachvollziehbar erscheint.570 Heinrich Brünings Wirtschaftspolitik bestand im Kern in der Durchsetzung einer strikten Deflationspolitik, die eine weitere Verschärfung der negativen Folgen der Weltwirtschaftskrise bewusst in Kauf nahm, um die Unhaltbarkeit der alliierten Reparationsforderungen zu verdeutlichen. Sie hatte insofern Erfolg, als sie in der Tat zunächst im Juni 1931 zu einem einjährigen Moratorium der Reparationszahlungen und dann schließlich mit dem am 9. Juli 1932 unterzeichneten Lausanner Vertrag sogar zu einer kompletten Streichung der Reparationsforderungen der Alliierten führte.571 Die volkswirtschaftlichen und sozialen Folgen dieser krisenverschärfenden „Politik der nackten Not“572 waren jedoch desaströs. Sie führte zu Massenarbeitslosigkeit und zu einer Verelendung großer Teile der Bevölkerung, die sich wiederum in Apathie, erhöhter Gewaltbereitschaft und poli- 568 Vgl. Mai, Die Weimarer Republik, S. 92ff.; Thoß, Demokratie ohne Demokraten, S. 131ff.; Kluge, Die Weimarer Republik, S. 361ff. 569 Vgl. Thoß, Demokratie ohne Demokraten, S. 136ff; Sturm, Weimarer Republik, S. 58 f.; Gessner, Die Weimarer Republik, S. 22 f.; Funke, Republik im Untergang, S. 508 f.; Wirsching, Die Weimarer Republik, S. 35 f. 570 Vgl. Peukert, Die Weimarer Republik, S. 257 f.; Wirsching, Die Weimarer Republik, S. 36; Niedhart, Deutsche Geschichte, S. 134. 571 Vgl. G. Meyer, Die Reparationspolitik – Ihre außen- und innenpolitischen Rückwirkungen, in: K. D. Bracher, M. Funke, H.-A. Jacobsen [Hrsg.], Die Weimarer Republik 1918-1933 – Politik, Wirtschaft, Gesellschaft, Düsseldorf 1987, S. 341ff.; Thoß, Demokratie ohne Demokraten, S. 140 f. und S. 157 f.; Kolb, Deutschland, S. 195ff.; Bracher, Die Auflösung der Weimarer Republik, S. 485ff. 572 Funke, Republik im Untergang, S. 508. III. Historische Grundlagen 128 tischer Radikalisierung bemerkbar machten, wovon vor allem die KPD und die NSDAP profitierten.573 Wenig überraschend stieg auch die politische Gewalt, die in den Jahren zwischen 1924 und 1929 deutlich abgenommen hatte, ab 1930 wieder deutlich an. Gewaltsame Auseinandersetzungen insbesondere zwischen Nationalsozialisten, Kommunisten und Sozialdemokraten, an denen sich zwangsläufig auch die Polizei beteiligte, bis hin zum politischen Mord sowie zunehmend auch nationalsozialistische Übergriffe gegen Juden häuften sich im Laufe des Jahres 1930 und vor allem im Reichstagswahlkampf.574 Die meisten dieser Auseinandersetzung spielten sich zwischen Kommunisten und Nationalsozialisten ab, wobei die meisten Todesopfer eindeutig unter den Kommunisten zu beklagen waren.575 Gerade das rechtsextreme politische Lager initiierte ab 1930 zudem zahlreiche, durchaus spektakuläre, gegen die staatliche Ordnung gerichtete Aktionen, z. B. die von der Unzufriedenheit der notleidenden Bauernschaft getriebenen, gewaltsamen Proteste der rechten ‚Landvolk-Bewegung‘ im Sommer und Herbst 1931 sowie zunehmend auch Massenaufmärsche der Nationalsozialisten und der ‚Harzburger Front‘, einem losen Bündnis von NSDAP und DNVP sowie weiterer rechter Verbände576, bei denen es oftmals zu gewaltsamen, teilweise auch bewaffneten Auseinandersetzungen mit linken Gegendemonstranten kam.577 Auch wenn man das Ausmaß der von der KPD ausgehenden politischen Gewalt nicht unterschätzen darf, so waren es in dieser Zeit aber vor allem die SA und die SS mit zusammen ca. 500.000 Mitgliedern sowie der damit verbündete ‚Stahlhelm-Frontsoldatenbund‘ mit etwa einer Million Mitgliedern, die „vielerorts die ‚Straße‘ beherrschten und die staatliche Autorität offen herausforderten“578. „Das blutige Jahr 1932“579 markierte dann einen weiteren Höhepunkt der politischen Gewalt. Dabei waren vor allem die Sommermonate in den Industrierevieren an Rhein und Ruhr sowie in Berlin von zahlreichen, äu- ßerst gewaltsamen, bewaffneten Auseinandersetzungen zwischen den paramilitärisch organisierten ‚Kampfverbänden‘ der KPD und der NSDAP mit 573 Vgl. Thoß, Demokratie ohne Demokraten, S. 142 f. 574 Vgl. Niedhart, Deutsche Geschichte, S. 126. 575 Vgl. Schumann, Politische Gewalt, S. 306 f. 576 Vgl. Bracher, Die Auflösung der Weimarer Republik, S. 360ff. 577 Vgl. Thoß, Demokratie ohne Demokraten, S. 143. 578 Kolb, Deutschland, S. 201. Vgl. auch Sturm, Weimarer Republik, S. 61; Marcowitz, Weimarer Republik 1929-33, S. 97 f. 579 Schumann, Politische Gewalt, S. 320. 2. Die deutsche Zwischenkriegszeit und ihre Sicherheitslage 129 mehreren Hundert Toten und mehreren Tausend Verletzten geprägt.580 Die sich in diesem ‚Paramilitarismus‘ widerspiegelnde Tendenz, politische Auseinandersetzungen gewaltsam zu auszutragen, gilt als charakteristisches Merkmal dieser Phase der Weimarer Republik und war zweifellos eine wesentliche Ursache für „die Bürgerkriegsatmosphäre Anfang der dreißiger Jahre“581. Diese gipfelte wohl am 17. Juli 1932 im so genannten ‚Altonaer Blutsonntag‘, als es nach einem Aufmarsch der SA in diesem Hamburger Arbeiterviertel zu stundenlangen, mit Schusswaffen ausgetragenen Stra- ßenkämpfen zwischen Nationalsozialisten, Kommunisten und der Polizei kam, die 18 Todesopfer und 61 Verletzte forderte und die der Reichsregierung eine Rechtfertigung bot, am 20. Juli 1932 die schon seit Monaten geplante Reichsexekution gegen den Freistaat Preußen – den so genannten ‚Preußenschlag‘ – zu vollziehen und damit die von der SPD geführte, seit der von der NSDAP gewonnen Landtagswahl am 24. April 1932 aber nur noch geschäftsführend amtierende, preußische Staatsregierung per „Staatsstreich“582 abzusetzen.583 Nach den Reichstagswahlen folgte ab August 1932 dann eine weitere Welle der Gewalt, die hauptsächlich von der SA ausging und vor allem in Ostpreußen sowie Schlesien erneut zahlreiche Todesopfer forderte.584 Als besonders prägendes Beispiel für die damalige Sicherheitslage gilt die Ermordung eines Kommunisten durch Angehörige der NSDAP und der SA am 11. August 1932 im oberschlesischen Potempa, die innerhalb weniger Tage zur Verhängung von fünf Todesurteilen gegen die Angeklagten führte. Nachdem sich Adolf Hitler persönlich mit den Verurteilten solidarisierte und der Reichsregierung den bewaffneten Kampf androhte, wurden diese Todesurteile zunächst innerhalb weniger Tage in lebenslängliche Zuchthausstrafen umgewandelt und nach wenigen Monaten sogar kom- 580 Vgl. Kluge, Die Weimarer Republik, S. 432 f.; H. A. Winkler, Die Weimarer Republik – Politik und Gesellschaft, München 1998, S. 489ff.; Schumann, Politische Gewalt, S. 320 f.; Thoß, Demokratie ohne Demokraten, S. 158; Niedhart, Deutsche Geschichte, S. 139. 581 Vgl. Wirsching, Die Weimarer Republik, S. 105 f. (Zitat: S. 106). 582 Winkler, Die Weimarer Republik, S. 503. 583 Vgl. Marcowitz, Weimarer Republik 1929-33, S. 108ff.; Winkler, Die Weimarer Republik, S. 490ff.; H. Heiber, Die Republik von Weimar, 22. Aufl., München 1996 (Erstveröffentlichung: 1966), S. 256ff.; Niedhart, Deutsche Geschichte, S. 139 f.; Kluge, Die Weimarer Republik, S. 432ff.; Thoß, Demokratie ohne Demokraten, S. 158ff.; Kolb, Deutschland, S. 205 f. 584 Vgl. Kluge, Die Weimarer Republik, S. 444 f.; Winkler, Die Weimarer Republik, S. 507 f.; Marcowitz, Weimarer Republik 1929-33, S. 112 f. III. Historische Grundlagen 130 plett aufgehoben.585 Die sich darin widerspiegelnde Rechtsunsicherheit und mangelnde Durchsetzungsfähigkeit der Staatsgewalt bezeugen die zunehmende Auflösung der Weimarer Republik. Auf der politischen Ebene begann dieser Auflösungsprozess bereits einige Monate zuvor mit dem Sturz des Reichskanzlers Heinrich Brüning, der nur durch den Reichspräsidenten erfolgen konnte, da seine Regierung nicht auf einer parlamentarischen Mehrheit beruhte.586 Ursächlich hierfür waren mehrere Faktoren, wie Paul von Hindenburgs Unzufriedenheit mit der von ihm als demütigend empfundenen Art und Weise, wie seine eigene Wiederwahl zustande gekommen war587, und der politische Druck der Unternehmerschaft sowie der ostelbischen Agrarier, die der ihrer Ansicht nach ‚zu linken‘ Politik Heinrich Brünings zunehmend kritisch gegen- überstanden. Der entscheidende Anlass für den Sturz des Reichskanzlers war dann schließlich aber das von ihm am 13. April 1932 per Notverordnung durchgesetzte Verbot der immer aggressiver und gewaltsamer auftretenden SA und SS, das vom rechten politischen Lager wie auch vom Reichspräsidenten abgelehnt wurde. Das führte schließlich dazu, dass Paul von Hindenburg Heinrich Brüning das Instrument der Notverordnungen verweigerte, woraufhin dieser am 30. Mai 1932 zurücktreten musste.588 Sein Nachfolger wurde der westfälische Adelige Franz von Papen, dessen am 1. Juni 1932 vorgestellte Regierung als Gegenleistung für die Aufhebung des Verbots der SA und der SS und die Ansetzung von Neuwahlen zum Reichstag von der NSDAP toleriert wurde. Bei den Reichstagswahlen am 31. Juli 1932 siegte die NSDAP (37,3%) mit großem Abstand vor der SPD (21,6%) und der KPD (14,3%), so dass nun mehr als die Hälfte der Reichstagsabgeordneten Parteien angehörten, die das parlamentarische System der Weimarer Republik offen ablehnten. Auf die Weigerung des Reichspräsidenten, dem NSDAP-Vorsitzenden Adolf Hitler das Kanzleramt zu übertragen, reagierten die Nationalsozialisten neben der bereits oben erwähnten Welle des politischen Terrors durch die SA auch mit im- 585 Vgl. Thoß, Demokratie ohne Demokraten, S. 163 f.; Marcowitz, Weimarer Republik 1929-33, S. 113. 586 Vgl. Heiber, Die Republik von Weimar, S. 249. 587 Vgl. Bracher, Die Auflösung der Weimarer Republik, S. 391ff., insb. S. 408 f. und S. 417 f.; Wirsching, Die Weimarer Republik, S. 36. 588 Vgl. Kolb, Deutschland, S. 198ff.; Funke, Republik im Untergang, S. 509ff.; Bracher, Die Auflösung der Weimarer Republik, S. 424ff.; Heiber, Die Republik von Weimar, S. 244ff.; Wirsching, Die Weimarer Republik, S. 36ff.; Thoß, Demokratie ohne Demokraten, S. 147ff. 2. Die deutsche Zwischenkriegszeit und ihre Sicherheitslage 131 mer deutlicheren Drohungen eines gewaltsamen Staatsumsturzes.589 Im Zuge einer vom Reichspräsidialamt geplanten, umfassenden Verfassungsreform und aus Anlass einer tarifrechtlichen Auseinandersetzung wurde der Reichstag am 12. September 1932 erneut aufgelöst, und es wurden Neuwahlen für den 6. November 1932 festgesetzt. Ein von massiver politischer Gewalt und zahlreichen Streiks und Protesten begleiteter Wahlkampf mündete schließlich in ein Wahlergebnis, bei dem die NSDAP zwar deutliche Stimmenverluste (33,1%) verzeichnete, aber dennoch erneut stärkste Fraktion vor der SPD (20,4%) und der KPD (16,9%) wurde, so dass republikfeindliche Parteien weiterhin die Mehrheit der Abgeordneten stellten. Angesichts der Weigerung der NSDAP, eine von Franz von Papen geführte Regierung zu unterstützen, trat dieser am 17. November 1932 zurück.590 Neuer Reichskanzler wurde am 3. Dezember 1932 der Ex-General, enge Vertraute des Reichpräsidenten und bisherige Reichswehrminister Kurt von Schleicher. Nachdem sich aber Adolf Hitler weiterhin weigerte, die NSDAP an einer nicht von ihm geführten Regierung zu beteiligen, und auch die von Kurt von Schleicher wohl ernsthaft in Erwägung gezogene Errichtung einer Militärdiktatur am Widerstand des Reichspräsidenten scheiterte, musste auch er am 28. Januar 1933 zurücktreten. Schließlich wurde am 30. Januar 1933, nachdem sich mittlerweile Franz von Papen und Adolf Hitler auf eine gemeinsame Regierung geeinigt hatte, letztgenannter zum Reichskanzler einer zwar von der stärksten Reichstagsfraktion getragenen, aber dennoch nicht auf einer parlamentarischen Mehrheit beruhenden Regierung ernannt.591 Damit „gelangte die Regierungsgewalt de facto in die Hände der erbittertsten Gegner der Demokratie und des 589 Vgl. Niedhart, Deutsche Geschichte, S. 138ff.; Peukert, Die Weimarer Republik, S. 258; Kolb, Deutschland, S. 203ff.; Sturm, Weimarer Republik, S. 61 und S. 64ff. 590 Vgl. U. Hörster-Philipps, Conservative Concepts of Dictatorship in the Final Phase of the Weimar Republic – The Government of Franz von Papen, in: in: M. N. Dobkowski, I. Wallimann [Hrsg.], Towards the Holocaust: the social and economic collapse of the Weimar Republic, Westport u. a. 1983, S. 115ff. und insb. S. 122ff.; Bracher, Die Auflösung der Weimarer Republik, S. 565ff.; Funke, Republik im Untergang, S. 514 f.; Thoß, Demokratie ohne Demokraten, S. 164ff.; Wirsching, Die Weimarer Republik, S. 39ff. 591 Vgl. Bracher, Die Auflösung der Weimarer Republik, S. 580ff; Remmling, Prologue: Weimar Society in Retrospect, S. 12 f.; Sturm, Weimarer Republik, S. 67ff.; Kolb, Deutschland, S. 210ff.; Thoß, Demokratie ohne Demokraten, S. 172ff.; Mai, Die Weimarer Republik, S. 102ff.; Funke, Republik im Untergang, S. 518ff. III. Historische Grundlagen 132 Parlamentarismus“592 und eines Mannes, „der nie ein Hehl daraus gemacht hatte, daß sein Ziel die Zerstörung der Republik, die Abschaffung der Demokratie, die brutale Unterdrückung und Verfolgung aller politischen Gegner war“593. Auch wenn sich die formale Errichtung einer totalen Diktatur in Form eines ‚Führerstaates‘ noch über einen längeren Zeitraum hinzog und wohl erst mit dem Tod Paul von Hindenburgs am 2. August 1934 ihren Abschluss fand, erscheint es durchaus angebracht, das Ende der Weimarer Republik auf den 30. Januar 1933 zu datieren.594 „Weimar society was dead“595, stellt Gunter W. Remmling treffend fest, und auch Karl- Dietrich Bracher kommt zu dem Ergebnis: „Hier, und nicht erst mit Reichstagsbrand, Tag von Potsdam und Ermächtigungsgesetz begann die nationalsozialistische Revolution, die der Auflösung der Weimarer Republik die Zerstörung Deutschlands und seiner europäischen Nachbarn in einem Inferno von Gewalt und Vernichtung folgen ließ.“596 Nationalsozialistische Herrschaft (1933-39) Auch wenn Adolf Hitler – wie seine drei Vorgänger Heinrich Brüning, Franz von Papen und Kurt von Schleicher – auf der Grundlage einer vom Reichpräsidenten erlassenen Notverordnung Reichskanzler wurde, so zeigte sich bereits unmittelbar nach seinem Amtsantritt, dass sich dieses Präsidialregime hinsichtlich seiner Ziele deutlich von seinen Vorgängern unterschied. Im Mittelpunkt standen von Anfang an – wie Adolf Hitler auch stets angekündigt hatte – die Abschaffung des Parlamentarismus, die Errichtung einer autoritären Diktatur und die Zerschlagung jeder politischen Opposition und insbesondere der KPD, der SPD sowie der Gewerkschaften.597 Dass diese Ziele innerhalb kürzester Zeit tatsächlich erreicht d) 592 Thoß, Demokratie ohne Demokraten, S. 179. 593 Kolb, Deutschland, S. 215. 594 Vgl. Mai, Die Weimarer Republik, S. 121ff.; G. Jasper, Die gescheiterte Zähmung – Wege zur Machtergreifung Hitlers 1930-1934, Frankfurt a. M. 1986, S. 8ff. 595 Remmling, Prologue: Weimar Society in Retrospect, S. 13. 596 Bracher, Die Auflösung der Weimarer Republik, S. 638. 597 Vgl. G. Plum, Übernahme und Sicherung der Macht 1933/34, in: M. Broszat, N. Frei [Hrsg.], Das Dritte Reich im Überblick: Chronik, Ereignisse, Zusammenhänge, 5. Aufl., München u. a. 1996, S. 34; Mai, Die Weimarer Republik, S. 121. 2. Die deutsche Zwischenkriegszeit und ihre Sicherheitslage 133 wurden, lag vor allem an der von Adolf Hitler verfolgten, in dieser Form neuartigen politischen Taktik, die Macht seiner Regierung durch pseudolegale Maßnahmen auf der legislativen Ebene auszuweiten und zugleich nicht im Detail geplanten, oftmals spontan von lokalen SA-Führern initiierten ‚Straßenterror‘ als politische Waffe einzusetzen.598 Gerade diese „paradoxe Mischung von scheinbarer Legalität und gleichzeitigem Terror“599, von legislativen Maßnahmen in Form von präsidialen Notverordnungen und dem radikalen, äußerst gewaltsamen, oftmals ungeplanten, keiner rechtsstaatlichen Kontrolle unterliegenden Vorgehen insbesondere der SA gegen ihre politischen Gegner erstickten jeden Widerstand schon im Ansatz und erzeugte eine „revolutionäre Dynamik, die […] die politische Ordnung Deutschlands insgesamt innerhalb weniger Monate fundamental veränderte“600. Am Anfang dieses Prozesses stand Adolf Hitlers sofortige Forderung nach Neuwahlen, der der Reichpräsident umgehend nachkam. Im dann folgenden Wahlkampf bis zum Wahltermin am 5. März 1933 setzte das nationalsozialistische Regime die eben beschriebene Strategie erstmals in die Praxis um.601 Eine zentrale Rolle spielte dabei die Tatsache, dass die Nationalsozialisten nicht nur das Reichsministerium des Innern, sondern auch das preußische Innenministerium über den zum Reichskommissar ernannten Hermann Göring leiteten und damit den Großteil der deutschen Polizei kontrollierten.602 Die rasch vollzogene ‚politische Säuberung‘ der Verwaltung und die Übernahme von 50.000 Hilfspolizisten aus den Reihen der SA, der SS und des ‚Stahlhelms‘ verstärkten diese Kontrolle über die Polizei noch. Zudem wurden mit der ‚Verordnung des Reichspräsidenten zum Schutze des Deutschen Volkes‘ vom 4. Februar 1933 und der so genannten ‚Reichstagsbrandverordnung‘ vom 28. Februar 1933 die verfas- 598 Vgl. L. Herbst, Das nationalsozialistische Deutschland 1933-1945, Frankfurt a. M. 1996, S. 62; Bernecker, Europa zwischen den Weltkriegen, S. 76; Bauer, Nationalsozialismus, S. 197; U. von Hehl, Nationalsozialistische Herrschaft, München 1996, S. 5; Plum, Übernahme und Sicherung der Macht, S. 41 f. Zur spontanen Dimension dieser Taktik vgl. H.-U. Wehler, Der Nationalsozialismus – Bewegung, Führerherrschaft, Verbrechen 1919-1945, München 2009, S. 61 f. 599 U. Thamer, Der Nationalsozialismus, Stuttgart 2002, S. 99. 600 M. Wildt, Geschichte des Nationalsozialismus, Göttingen 2008, S. 74. 601 Vgl. Frei, Der Führerstaat, S. 45ff. 602 Vgl. Plum, Übernahme und Sicherung der Macht, S. 35 f.; K. Hildebrand, Geschichte des Dritten Reiches, München 2012, S. 9 f.; Wildt, Geschichte des Nationalsozialismus, S. 74 f.; Herbst, Das nationalsozialistische Deutschland, S. 63; M. Brechtken, Die nationalsozialistische Herrschaft 1933-1939, 2. Aufl., Darmstadt 2012, S. 22. III. Historische Grundlagen 134 sungsmäßigen Grundrechte – insbesondere die Presse-, Vereins-, Meinungs- und Versammlungsfreiheit – massiv eingeschränkt oder sogar komplett außer Kraft gesetzt, der Polizei die Verhaftung von Verdächtigen ohne Begründung, Befristung oder Rechtschutz ermöglicht (‚Schutzhaft‘) und damit der Regierung „unbegrenzte quasi-legale Möglichkeiten“603 eröffnet.604 Die Auswirkungen dieser eigentümlichen Mischung aus Rechtsunsicherheit und staatlichem Terror beschreibt Klaus Hildebrand folgendermaßen: „Im Prinzip war damit der permanente Ausnahmezustand erklärt, und die Verfolgung sowie Terrorisierung politischer Gegner durch die Regierung erhielten damit den Schein des Legalen. […] Weil im totalitären Unrechtsstaat, diametral verschieden zum demokratischen Rechtsstaat, auch nicht annähernd abzusehen war, was einen bei abweichendem, oppositionellem, gar widerständigem Verhalten erwartete – unter Umständen nichts Ernstes, aber mit gleicher Ungewissheit auch das Schlimmste –, weil tyrannische Willkür berechenbare Verfahren verdrängte, wurden Bürger, weil sie nun einmal Menschen sind, leicht zu ‚Feiglingen aus Instinkt‘.“605 Unter diesen Rahmenbedingungen erreichte die von der SA und SS ausgehende politische Gewalt im Wahlkampf nicht nur bisher ungekannte Ausmaße, sondern auch eine neue Qualität.606 Es kam zur Schließung und Verwüstung von KPD- und SPD-nahen Zeitungen, zu Überfällen auf republikanische Politiker und zu massiven, gewaltsamen Angriffen auf Wahlkampfveranstaltungen linker Parteien, die sich teilweise auch auf die Zentrumspartei erstreckten und bei denen die Polizei tatenlos zusah und nicht eingriff.607 Hierbei „knüppelten ihre Fußtruppen [die SA] die politischen Gegner in einem mehrwöchigen Gewaltrausch nieder“608, so dass bis zum Wahltag offiziell 69 Tote und Hunderte Verletzte zu beklagen waren. Zudem wurden vor allem nach dem Reichstagsbrand am 27. Februar 1933 Tausende Kommunisten – u. a. fast alle Reichstagabgeordneten der KPD – 603 Mai, Die Weimarer Republik, S. 123. 604 Vgl. Wehler, Der Nationalsozialismus, S. 58ff.; Bauer, Nationalsozialismus, S. 198ff.; Bernecker, Europa zwischen den Weltkriegen, S. 79; Herbst, Das nationalsozialistische Deutschland, S. 64. 605 Hildebrand, Geschichte des Dritten Reiches, S. 10. 606 Vgl. Frei, Der Führerstaat, S. 49 f. 607 Vgl. Thamer, Der Nationalsozialismus, S. 112 f.; Plum, Übernahme und Sicherung der Macht, S. 37.; Wildt, Geschichte des Nationalsozialismus, S. 74 f. 608 Brechtken, Die nationalsozialistische Herrschaft, S. 23. 2. Die deutsche Zwischenkriegszeit und ihre Sicherheitslage 135 verhaftet und in Gefängnisse, ‚Folterkeller‘ und ‚wilde‘ Konzentrationslager gebracht, wo sie misshandelt, gefoltert und teilweise sogar ermordet wurden.609 Bis Mitte März 1933 stieg die Zahl der verhafteten politischen Gegner noch einmal sehr deutlich an, wobei die Angaben in der Literatur sehr stark schwanken.610 Richard J. Evans zufolge wurden 4.000 Personen unmittelbar nach dem Reichstagsbrand verhaftet, bis Ende März stieg diese Zahl auf 20.000 und bis zum Sommer auf über 100.000 an, von denen ca. 600 während dieser ‚Schutzhaft‘ starben.611 Vor diesem Hintergrund verwundert es, dass die NSDAP die Wahlen am 5. März 1933 zwar mit einem Stimmenanteil von 43,9% deutlich gewann, allerdings eine absolute Mehrheit verfehlte und nur mit der DNVP zusammen regieren konnte, während immerhin mehr als ein Drittel der Stimmen trotz der massiven Repressalien, denen sich die SPD (18,3%) und die KPD (12,3%) ausgesetzt sahen, auf diese beiden Parteien entfiel.612 Gleichwohl wurde die Außerkraftsetzung der republikanischen Verfassungsordnung und die Errichtung einer autoritären Diktatur nach der Reichstagswahl noch beschleunigt613, wobei weiterhin auf die bewährte Mischung aus legislativen Maßnahmen und staatlichem Terror zurückgegriffen wurde. Ein wesentlicher Schritt auf der legislativen Ebene war dabei die Verabschiedung des so genannten ‚Ermächtigungsgesetzes‘ am 23. März 1933, mit dem der Regierung das Recht zum eigenmächtigen Erlass von – sogar verfassungsändernden – Gesetzen verliehen wurde. Mit diesem Schritt ent- 609 Vgl. Herbst, Das nationalsozialistische Deutschland, S. 65; Wildt, Geschichte des Nationalsozialismus, S. 76 f.; Thamer, Der Nationalsozialismus, S. 122; Plum, Übernahme und Sicherung der Macht, S. 38ff.; Frei, Der Führerstaat, S. 451 f.; Hehl, Nationalsozialistische Herrschaft, S. 5; Bauer, Nationalsozialismus, S. 200 f.; D. Pohl, Verfolgung und Massenmord in der NS-Zeit 1933-1945, 3. Aufl., Darmstadt 2011, S. 11. 610 L. Herbst und U. Thamer gehen von 100.000 Verhaftungen bis Mitte März aus; vgl. Herbst, Das nationalsozialistische Deutschland, S. 65; Thamer, Der Nationalsozialismus, S. 122. K. Bauer nennt die deutlich geringere Zahl von 10.000 Verhafteten; vgl. Bauer, Nationalsozialismus, S. 201. H.-U. Wehler, spricht sogar nur von 7.500 Verhafteten; vgl. Wehler, Der Nationalsozialismus, S. 60. W. L. Bernecker geht hingegen von 10.000 Verhaftungen allein in der Nacht nach dem Reichstagsbrand aus; vgl. Bernecker, Europa zwischen den Weltkriegen, S. 79. Nach D. Pohl wurde die höchste Zahl im April mit 50.000 Verhafteten erreicht; vgl. Pohl, Verfolgung und Massenmord, S. 11. 611 Vgl. R. J. Evans, Das Dritte Reich, Bd. II: Diktatur, München 2010, S. 17. 612 Vgl. Brechtken, Die nationalsozialistische Herrschaft, S. 23 f.; Wildt, Geschichte des Nationalsozialismus, S. 77; Herbst, Das nationalsozialistische Deutschland, S. 65; Bauer, Nationalsozialismus, S. 202ff. 613 Vgl. Herbst, Das nationalsozialistische Deutschland, S. 66. III. Historische Grundlagen 136 machtete sich das Parlament nicht nur selbst, sondern auch den Reichspräsidenten, dessen präsidialen Notverordnungen nun von der Regierung nicht mehr benötigt wurden. Die hierfür erforderliche Zweidrittelmehrheit im Reichstag wurde mit einer Mischung aus Verhaftungen und massiven Drohungen gegenüber den Abgeordneten der SPD und KPD sowie vagen Versprechungen und psychologischem Druck gegenüber den restlichen Abgeordneten problemlos erreicht.614 Und nur wenige Tage darauf wurde am 31. März und am 7. April 1933 die Abschaffung des Parlamentarismus mit den so genannten ‚Gleichschaltungsgesetzen‘ auf alle deutschen Länder übertragen, in denen nun von Adolf Hitler eingesetzte Reichsstatthalter die faktische Landesgewalt übernahmen, bis schließlich am 30. Januar 1934 mit dem ‚Gesetz über den Neuaufbau des Reiches‘ die Hoheitsrechte der Länder komplett auf das Reich übertragen wurden, was das Ende des Föderalismus bedeutete.615 Weitere, für die Formierung des diktatorischen Führerstaates wichtige legislative Maßnahmen waren schließlich die so genannten ‚Aprilgesetze‘ von 1933, die die Verwaltung, das Bildungswesen, das Gesundheitswesen sowie den Anwalts- und Richterstand von Juden, Kommunisten, Sozialisten und sonstigen dem Nationalsozialismus kritisch gegenüberstehenden Personen ‚säubern‘ sollten.616 Begleitet wurden diese legislativen Maßnahmen von einer Welle der Gewalt, die für die Errichtung der nationalsozialistischen Diktatur mindestens genauso wichtig war. So ging den oben angeführten ‚Gleichschaltungsgesetzen‘ die gewaltsame Machtübernahme in den nicht nationalsozialistisch regierten Ländern voraus, indem die SA zunächst Demonstrationen, Amtserstürmungen und sonstige Krawalle in den Ländern organisierte, die der Reichsregierung dann als Vorwand dienten, auf der Grundlage der ‚Reichstagsbrandverordnung‘ die Länderregierungen abzusetzen, die Länderparlamente zu entmachten und Nationalsozialisten als Reichskommissare oder kommissarische Polizeipräsidenten einzusetzen, die die faktische Landesgewalt übernahmen, um Ruhe und Ordnung ‚wiederherzustel- 614 Vgl. Wildt, Geschichte des Nationalsozialismus, S. 78; Bauer, Nationalsozialismus, S. 204 f.; Plum, Übernahme und Sicherung der Macht, S. 45; Brechtken, Die nationalsozialistische Herrschaft, S. 26. 615 Vgl. Thamer, Der Nationalsozialismus, S. 125ff.; Bauer, Nationalsozialismus, S. 205ff.; Hehl, Nationalsozialistische Herrschaft, S. 7 f.; Wehler, Der Nationalsozialismus, S. 61 f. 616 Herbst, Das nationalsozialistische Deutschland, S. 77 f.; Frei, Der Führerstaat, S. 66 f.; Thamer, Der Nationalsozialismus, S. 165ff.; Hehl, Nationalsozialistische Herrschaft, S. 7; Wildt, Geschichte des Nationalsozialismus, S. 80 f. 2. Die deutsche Zwischenkriegszeit und ihre Sicherheitslage 137 len‘.617 Während diese Aktionen wegen der politischen Resignation der Länderregierungen auf wenig Widerstand stießen und daher mit einem relativ geringen Ausmaß an Gewalt verbunden waren, kam es an vielen anderen Stellen aber zu massiven Übergriffen gegen politische Gegner – vor allem gegen Anhänger der KPD und SPD, aber zunehmend auch anderer Parteien wie der Zentrumspartei, sowie gegen Gewerkschafter – und Juden, die „von Zeitzeugen und Historikern zu Recht mit dramatischen Vokabeln wie Hexenkessel, Hunnensturm, Anarchie, Amoklauf etc. belegt [wurden]“618. Dabei wurden insbesondere Arbeiterheime, Gewerkschaftshäuser, Parteibüros, Synagogen und Geschäfte jüdischer Besitzer gestürmt, geplündert und teilweise in Brand gesteckt, Krankenhäuser, Arztpraxen und Gerichte gestürmt, um jüdische Ärzte und Richter mit gewaltsamen Mitteln zu verjagen, Sozialdemokraten, Republikaner, Intellektuelle und Juden auf offener Straße oder in ihren Privatwohnungen überfallen, misshandelt, oftmals verhaftet, in ‚wilde‘ oder reguläre Konzentrationslager verschleppt und teilweise ermordet.619 Eine besonders gewaltsame Aktion war die ‚Köpenicker Blutwoche‘, bei der in diesem Berliner Stadtteil zwischen dem 21. und dem 26. Juli 1933 ca. 500 dem linken politischen Spektrum zuzurechnende Personen und Juden durch die SA entführt und gefoltert wurden, von denen mindestens 24 – möglicherweise sogar über 90 – ermordet wurden.620 Ähnliche, wenn auch mit weniger Todesopfern verbundene Gewalttaten fanden im weiteren Verlauf von 1933 und in der ersten Jahreshälfte 1934 in fast allen Teilen des Reiches statt, so dass Schätzungen von 600 bis 1.000 Todesopfern dieser landesweiten Welle der Gewalt ausgehen.621 Vor dem Hintergrund solcher Gewaltexzesse verwundert es nicht, dass zahlreiche Personen und Organisationen freiwillig kapitulierten. Dies gilt 617 Vgl. Plum, Übernahme und Sicherung der Macht, S. 40 f.; Herbst, Das nationalsozialistische Deutschland, S. 66 f.; Bauer, Nationalsozialismus, S. 205 f.; Thamer, Der Nationalsozialismus, S. 125ff.: Hildebrand, Geschichte des Dritten Reiches, S. 15; Frei, Der Führerstaat, S. 55 f. 618 Bauer, Nationalsozialismus, S. 215. 619 Vgl. Bauer, Nationalsozialismus, S. 215ff.; Pohl, Verfolgung und Massenmord, S. 11 f. 620 G. Flick, Die Köpenicker Blutwoche – Fakten, Legenden und politische Justiz, in: Zeitschrift des Forschungsverbundes SED-Staat, 2007, Nr. 21, S. 3ff.; S. Hördler, SA-Terror als Herrschaftssicherung – Köpenicker Blutwoche und öffentliche Gewalt im Nationalsozialismus, in: S. Hördler [Hrsg.], SA-Terror als Herrschaftssicherung – Köpenicker Blutwoche und öffentliche Gewalt im Nationalsozialismus, Berlin 2013, S. 9ff. 621 Vgl. Pohl, Verfolgung und Massenmord, S. 12. III. Historische Grundlagen 138 insbesondere für die Gewerkschaften, die sich seit der Ernennung von Adolf Hitler zum Reichskanzler zunehmend von der SPD distanzierten und mit dem Nationalsozialismus und dessen sozialpolitischen Versprechungen sympathisierten. Gleichwohl begann die Zerschlagung der Gewerkschaften erneut mit einer gewaltsamen Aktion, nämlich mit der Besetzung der Gewerkschaftshäuser, der Beschlagnahme des Vermögens und der Verhaftung einiger führender Vorstandsmitglieder des Allgemeinen Deutschen Gewerkschaftsbundes (ADGB) – mit 4,5 Millionen Mitgliedern die eindeutig stärkste gewerkschaftliche Kraft – durch SA-Truppen am 2. Mai 1933. In den folgenden Monaten lösten sich der ADGB sowie alle anderen Gewerkschaften dann freiwillig auf und gingen in der am 10. Mai 1933 gegründeten Deutschen Arbeitsfront (DAF) auf, die bald als Einheitsgewerkschaft und Zwangsvereinigung für sämtliche Arbeitnehmer und Arbeitgeber fungierte.622 Und auch die Auflösung der Parteien verlief – mit Ausnahme der bereits unmittelbar nach dem Reichstagsbrand gewaltsam zerschlagenen KPD und der massiven Verfolgungen und Verhaftungen ausgesetzten und letztlich am 22. Juli 1933 offiziell verbotenen SPD – auf freiwilliger Basis. Zwischen dem 27. Juni und dem 5. Juli 1933 lösten sich alle bürgerlichen Parteien auf ‚sanften‘ Druck der Reichsregierung, vor allem aber aufgrund der von diesen Parteien mehr oder weniger deutlich propagierten Demokratiefeindlichkeit, die Parteien verzichtbar machte, auf.623 Mit dem ‚Gesetz gegen die Neubildung von Parteien‘ wurde am 14. Juli 1933 die NSDAP zur einzigen politischen Partei erklärt und damit „der Prozeß der nationalsozialistischen Machtmonopolisierung abgeschlossen“624 und die „parlamentarische Demokratie [… in Deutschland …] zu Grabe getragen“625. Dass diese Entwicklung keinesfalls nur das Ergebnis von Gewalt und Unterdrückung war, sondern durchaus auf breite Zustimmung in der Bevölkerung stieß, zeigte die am 12. November 1933 durchgeführte Volksbefragung und Reichstagswahl, die bei einer Wahlbeteili- 622 Vgl. Frei, Der Führerstaat, S. 70ff.; Wildt, Geschichte des Nationalsozialismus, S. 81; Wehler, Der Nationalsozialismus, S. 66 f.; Herbst, Das nationalsozialistische Deutschland, S. 69 f.; Brechtken, Die nationalsozialistische Herrschaft, S. 28 f. 623 Vgl. Bauer, Nationalsozialismus, S. 211ff.; Frei, Der Führerstaat, S. 80ff.; Hildebrand, Geschichte des Dritten Reiches, S. 22 f.; Herbst, Das nationalsozialistische Deutschland, S. 70ff.; Brechtken, Die nationalsozialistische Herrschaft, S. 29 f.; Thamer, Der Nationalsozialismus, S. 142ff.; Evans, Das Dritte Reich, S. 19 f.; Wehler, Der Nationalsozialismus, S. 67 f. 624 Frei, Der Führerstaat, S. 84. 625 Thamer, Der Nationalsozialismus, S. 149. 2. Die deutsche Zwischenkriegszeit und ihre Sicherheitslage 139 gung von über 95% eine Zustimmung von ca. 95% zu Adolf Hitlers Politik und von ca. 92% zu seiner NSDAP-Einheitsliste ergab.626 Dem Alleinherrschaftsanspruch der NSDAP entzogen sich Anfang 1934 nur noch die Reichswehr und der Reichspräsident. Zudem stellte die SA mittlerweile „einen virulenten Unruheherd“627 dar, der sich vor allem auf der lokalen Ebene kaum noch von der NSDAP-Führung kontrollieren ließ.628 Als schließlich im Juni 1934 der Druck der Reichswehr und des Reichspräsidenten zunahm, die SA als ‚Unruheherd‘ auszuschalten, handelte Adolf Hitler auf eine Art und Weise, die die damaligen Sicherheitslage, aber auch den verbrecherischen Charakter dieses Regimes verdeutlichte, „denn es handelte dich um einen kaltblütigen, staatlich organisierten und nachträglich sanktionierten massenhaften politischen Mord, der zutiefst gegen die rechtsstaatliche Tradition verstieß und in seinem Ablauf dem Wüten einer Gangsterbande ähnelte“629. Am 30. Juni 1934 wurde unter dem Vorwand, dass die SA einen Putsch geplant hätte, die gesamte SA-Führung – und damit auch ihr Leiter Ernst Röhm – in Bad Wiessee sowie deutschlandweit zahlreiche weitere lokale SA-Führer und sonstige, von der NS-Führung als politische Bedrohung wahrgenommene Personen – z. B. der ehemalige Reichskanzler Kurt von Schleicher und der ehemalige Reichspropaganda- und Reichsorganisationsleiter der NSDAP Gregor Strasser – von Angehörigen der SS, des Sicherheitsdienstes des Reichsführers-SS (SD) und der Geheimen Staatspolizei (Gestapo) verhaftet und ermordet.630 Diese mindestens 85, vermutlich aber eher 150 bis 200 Morde631, die am 3. Juli 1934 ex post durch eine legislative Maßnahme als ‚Staatsnotwehr‘ deklariert und damit legalisiert wurden, trafen bei der Bevölkerung auf „bemerkenswerte Zustimmung“632 und wurden auch von der Reichswehr und dem Reichspräsidenten wohl- 626 Vgl. Frei, Der Führerstaat, S. 93 f.; Wehler, Der Nationalsozialismus, S. 71 f.; Bauer, Nationalsozialismus, S. 234. 627 Wildt, Geschichte des Nationalsozialismus, S. 85. 628 Vgl. Bauer, Nationalsozialismus, S. 236ff.; Evans, Das Dritte Reich, S. 27ff.; Thamer, Der Nationalsozialismus, S. 168 f.; Frei, Der Führerstaat, S. 17ff.; Herbst, Das nationalsozialistische Deutschland, S. 111 f.; Hildebrand, Geschichte des Dritten Reiches, S. 24. 629 Thamer, Der Nationalsozialismus, S. 170. 630 Vgl. Evans, Das Dritte Reich, S. 41ff.; Frei, Der Führerstaat, S. 29ff.; Wehler, Der Nationalsozialismus, S. 76; Hehl, Nationalsozialistische Herrschaft, S. 9. 631 Vgl. Bauer, Nationalsozialismus, S. 243. 632 Wehler, Der Nationalsozialismus, S. 77. III. Historische Grundlagen 140 wollend geduldet. Adolf Hitler schaltete auf diese Weise nicht nur die SA dauerhaft als Machtfaktor aus, sondern er steigerte zudem seine eigene Popularität.633 Wenige Wochen später, am 2. August 1934, wurde auf der Grundlage eines am Vortag erlassenen Gesetzes mit dem Tod von Paul von Hindenburg das Amt des Reichspräsidenten mit dem des Reichskanzlers vereinigt und damit abgeschafft. Am gleichen Tag noch verpflichtete sich die Reichswehr mittels einer von der Reichswehrführung auf eigene Initiative hin neu entworfenen Eidesformel zu unbedingtem Gehorsam gegen- über dem ‚Führer des deutschen Volkes, Adolf Hitler‘. Als dann am 19. August 1934 eine Volksabstimmung diese Bündelung der Ämter des Regierungschefs, Staatsoberhaupts, Oberbefehlshabers der Streitkräfte und Führers der einzigen zugelassenen Partei in der Person Adolf Hitlers mit einer Zustimmungsquote von ca. 90% nachträglich bestätigte, war der totalitäre nationalsozialistische Führerstaat konstituiert.634 In den nun folgenden ca. 4 Jahren ab August 1934 konnten die Nationalsozialisten zumindest unter innenpolitischen Gesichtspunkten relativ frei regieren und die deutsche Gesellschaft gemäß ihren Vorstellung umgestalten.635 Diese Periode wird in der Literatur im Allgemeinen als die ‚guten‘, ‚friedlichen‘ Jahre des Nationalsozialismus bezeichnet, was der Wahrnehmung der Lebensumstände im damaligen Deutschland durch den überwiegenden Teil der Bevölkerung entsprach und ganz erheblich zur Überwindung der in den ersten Jahren nach der nationalsozialistischen Machtübernahme durchaus vorhandenen regimekritischen Stimmungen beitrug.636 Dies lag vor allem am rasanten Aufstieg der deutschen Wirtschaft ab 1933, der vor allem im Vergleich zu der äußerst schlechten wirtschaftlichen Entwicklung in den letzten Jahren der Weimarer Zeit eine enorme Verbesserung darstellte. Wie Abbildung 2 verdeutlicht, sank das preisbereinigte Bruttosozialprodukt im Deutschen Reich im Zuge der 633 Vgl. Brechtken, Die nationalsozialistische Herrschaft, S. 38 f.; Thamer, Der Nationalsozialismus, S. 174 f.; Wehler, Der Nationalsozialismus, S. 76 f.; Frei, Der Führerstaat, S. 36ff. 634 Vgl. Brechtken, Die nationalsozialistische Herrschaft, S. 39 f.; Wildt, Geschichte des Nationalsozialismus, S. 86 f.; Frei, Der Führerstaat, S. 40 f.; Thamer, Der Nationalsozialismus, S. 175ff.; Wehler, Der Nationalsozialismus, S. 78ff.; Hehl, Nationalsozialistische Herrschaft, S. 9 f.; Hildebrand, Geschichte des Dritten Reiches, S. 26; Vgl. Bauer, Nationalsozialismus, S. 251ff. 635 Vgl. Frei, Der Führerstaat, S. 96 f. 636 Vgl. Bauer, Nationalsozialismus, S. 255; Frei, Der Führerstaat, S. 97; Thamer, Der Nationalsozialismus, S. 178 f.; W. Benz, Konsolidierung und Konsens 1934-1939, in: M. Broszat, N. Frei [Hrsg.], Das Dritte Reich im Überblick: Chronik, Ereignisse, Zusammenhänge, 5. Aufl., München u. a. 1996, S. 48. 2. Die deutsche Zwischenkriegszeit und ihre Sicherheitslage 141 Weltwirtschaftskrise zunächst von 70,5 Milliarden (Mrd.) Reichsmark im Jahr 1928 auf 59,1 Mrd. Reichsmark im Jahr 1932, um dann ab 1933 wieder anzusteigen und sich bis 1939 auf 107,2 Mrd. Reichsmark nahezu zu verdoppeln.637 Bruttosozialprodukt im Deutschen Reich 1925-1939 Die Ursachen für dieses ‚Wirtschaftswunder‘, das auch im internationalen Vergleich erstaunlich war und gemessen an den Produktionszuwächsen nur von der Sowjetunion und Japan übertroffen wurde638, waren vielfältig. Neben der Tatsache, dass sich bereits 1932 eine volkswirtschaftliche Trendwende und eine Belebung der internationalen Konjunktur andeuteten, war insbesondere das so genannte ‚Reinhard-Programm‘ – ein staatliches Investitionsprogramm in Höhe von ca. 1,5 Mrd. Reichsmark, das vor allem zur Finanzierung von öffentlichen Bauarbeiten und insbesondere des Baus der Reichsautobahnen verwendet wurde, das aber z. B. auch familienpolitische Maßnahmen enthielt – dafür verantwortlich.639 Die konjunkturbelebende Wirkung basierte dabei aber nicht nur auf der Investitionshöhe, Abb. 2: 637 Vgl. N. Räth, Rezessionen in historischer Betrachtung, in: Wirtschaft und Statistik, o. Jg. (2009), Nr. 3, S. 205ff.. 638 Vgl. Bernecker, Europa zwischen den Weltkriegen, S. 83. 639 Vgl. Evans, Das Dritte Reich, S. 400ff.; Brechtken, Die nationalsozialistische Herrschaft, S. 45ff.; Hildebrand, Geschichte des Dritten Reiches, S. 18; Bernecker, Europa zwischen den Weltkriegen, S. 84 f. III. Historische Grundlagen 142 sondern auch auf politischer Psychologie, da diese Maßnahmen mit einem enormen Aufwand und auf eine sehr populistische und medienwirksame Art und Weise kommuniziert wurden, um eine positiv-optimistische Grundstimmung in der Bevölkerung zu erzielen, Adolf Hitlers Image weiter zu verbessern und die ideologischen Ziele der NSDAP zu fördern. In diesem Sinne bildete „Propaganda […] fortan einen genuinen Bestandteil der Wirtschafts- und Sozialpolitik.“640 Von entscheidender Bedeutung für die allgemeine Wahrnehmung des wirtschaftlichen Aufschwungs als ‚nationalsozialistisches Wirtschaftswunder‘ war die Tatsache, dass sich das ökonomische Wachstum auch in der Lohnentwicklung und der Arbeitslosenstatistik niederschlug und damit auch in der Bevölkerung ‚ankam‘. Wie Abbildung 3 veranschaulicht, sank die Arbeitslosenquote, nachdem sie 1932 mit fast 30% ihren Höchststand erreicht hatte, innerhalb von zwei Jahren abrupt auf 13,5%, um anschlie- ßend kontinuierlich weiter zu fallen und 1938 und 1939 mit Werten von lediglich 1,9% und 0,5% ein Niveau zu erreichen, bei dem man angesichts der Annahme einer gewissen Sockelarbeitslosigkeit von Vollbeschäftigung oder sogar von einem Arbeitskräftemangel ausgehen kann.641 Zurückzuführen war dieser enorme Rückgang der Arbeitslosigkeit aber nicht nur auf die staatlichen Konjunkturprogramme, die vor allem öffentliche Bauvorhaben und damit personalintensive Handarbeit förderten, sondern auch auf Manipulationen der Arbeitsmarktstatistik, die Einführung der allgemeinen Wehrpflicht und einer sechsmonatigen Arbeitsdienstpflicht im Jahr 1935, was wiederum die ideologische Dimension dieser Maßnahmen verdeutlicht.642 Hinzu kam ein durchgängiger Anstieg der realen, effektiven Löhne zwischen 1932 und 1939 um insgesamt 23%, wobei zu berücksichtigen ist, dass erst 1938 das Niveau von vor der Weltwirtschaftskrise erreicht wurde.643 Dieser Lohnanstieg war umso erstaunlicher, als ab 1936 ein staatlich verordneter, allgemeiner Lohn- und Preisstopp in Kraft trat, der den Übergang markierte zu einer totalitären, auf die Vorbe- 640 Frei, Der Führerstaat, S. 98 f. 641 Vgl. D. Petzina, W. Abelshauser, A. Faust, Sozialgeschichtliches Arbeitsbuch III: Materialien zur Statistik des Deutschen Reiches 1914-1945, München 1978, S. 119 f.; Petzina, Autarkiepolitik im Dritten Reich, S. 167; Benz, Konsolidierung und Konsens, S. 48. 642 Vgl. Frei, Der Führerstaat, S. 99 f.; Wehler, Der Nationalsozialismus, S. 94ff.; Herbst, Das nationalsozialistische Deutschland, S. 89ff. 643 Vgl. D. Petzina, Autarkiepolitik im Dritten Reich – Der nationalsozialistische Vierteljahresplan, Stuttgart 1968, S. 167. 2. Die deutsche Zwischenkriegszeit und ihre Sicherheitslage 143 reitung des bevorstehenden Kriegs abzielenden Staatswirtschaft, die nun nicht mehr verdeckt, sondern offen der massiven Aufrüstung diente.644 Bei genauerer Betrachtung erweist sich der wirtschaftliche Aufschwung in den Jahren ab 1933 somit weniger als ‚nationalsozialistisches Wirtschaftswunder‘ und vielmehr als „eine reine Staatskonjunktur, die durch die Notenpresse finanziert wurde“645. Die betriebene Wirtschafts- und Finanzpolitik zielte vor allem auf die umfassende Mobilisierung und Militarisierung der Gesellschaft ab und diente dementsprechend primär der Aufrüstung und der Kriegsvorbereitung. Ludolf Herbst bezeichnet den Abbau der Arbeitslosigkeit als „kontingente Sekundärfolge von Hitlers Entschluß […], Deutschland kriegsfähig zu machen“646. Sie war weder nachhaltig noch diente sie der Verbesserung des Lebensstandards der Bevölkerung. Vielmehr stellte sie angesichts der rasant wachsenden, allerdings mit finanztechnischen Innovationen zunächst erfolgreich verschleierten Staatsverschuldung ein gewaltiges Inflationsrisiko dar. Dass unter diesen Bedingungen der Staatsbankrott langfristig unvermeidbar war, wurde vom NS- 644 Vgl. Benz, Konsolidierung und Konsens, S. 49 f.; Bernecker, Europa zwischen den Weltkriegen, S. 85; Hehl, Nationalsozialistische Herrschaft, S. 34; Wildt, Geschichte des Nationalsozialismus, S. 98; Evans, Das Dritte Reich, S. 410ff. und S. 434ff. 645 Bernecker, Europa zwischen den Weltkriegen, S. 85. 646 Herbst, Das nationalsozialistische Deutschland, S. 99. Arbeitslosigkeit und Lohnentwicklung im Deutschen Reich 1928-1939Abb. 3: III. Historische Grundlagen 144 Regime bewusst in Kauf genommen, da man von einem baldigen Eroberungskrieg ausging, der eine Sanierung der Staatsfinanzen ermöglichte, indem man die eroberten Gebiete ausplünderte.647 Die allgemeine Wahrnehmung der Jahre 1934 bis 1938 als ‚gute‘ Jahre des Nationalsozialismus basierte aber auch auf den außenpolitischen Erfolgen des Regimes, „die mit inzwischen uniformierter und perfektionierter Propaganda – bei gleichzeitiger Unterdrückung aller dagegen geltend zu machender Bedenken – überaus wirksam stilisiert und ausgeschlachtet wurde[n]“648. Den Anfang machte hierbei die Wiedereingliederung des Saargebietes auf der Grundlage der im Versailler Vertrag vorgesehenen Volksabstimmung, die am 13. Januar 1935 mit einer überwältigenden Mehrheit von ca. 90% für die Vereinigung mit dem Deutschen Reich endete und dem Hitler-Regime sowohl national wie auch international einen triumphalen Propagandaerfolg bescherte.649 Ermutigt durch diesen Erfolg verkündete er im März 1935 dann die Wiedereinführung der allgemeinen Wehrpflicht und die Institutionalisierung der Luftwaffe als Teil der nun als ‚Wehrmacht‘ firmierenden Reichswehr, was einen Bruch der Versailler Bestimmungen und Locarno-Verträge darstellte, der allerdings ohne praktische Konsequenzen blieb.650 Dementsprechend wagte Adolf Hitler ein Jahr später den nächsten eklatanten – und angesichts der militärischen Schwäche Deutschlands hochriskanten – Bruch der Versailler Bestimmungen und ließ am 7. März 1936 die Wehrmacht in das entmilitarisierte Rheinland einmarschieren, was trotz einer Verurteilung durch den Völkerbund erneut keine praktischen Folgen für das Deutsche Reich hatte.651 Im Ergebnis führte dieses von Adolf Hitler eigenmächtig und gegen die ausdrückliche Empfehlung der Wehrmachtsführung beschlossene „Vabanque- 647 Vgl. Brechtken, Die nationalsozialistische Herrschaft, S. 49ff.; Frei, Der Führerstaat, S. 100 f.; Bernecker, Europa zwischen den Weltkriegen, S. 86; Wildt, Geschichte des Nationalsozialismus, S. 98. 648 Benz, Konsolidierung und Konsens, S. 51. 649 Vgl. Wildt, Geschichte des Nationalsozialismus, S. 135 f.; Brechtken, Die nationalsozialistische Herrschaft, S. 131 f.; Herbst, Das nationalsozialistische Deutschland, S. 137. 650 Vgl. Thamer, Der Nationalsozialismus, S. 286 f.; Hildebrand, Geschichte des Dritten Reiches, S. 34; Brechtken, Die nationalsozialistische Herrschaft, S. 132 f. 651 Vgl. Herbst, Das nationalsozialistische Deutschland, S. 144ff.; Wildt, Geschichte des Nationalsozialismus, S. 136 f.; Hildebrand, Geschichte des Dritten Reiches, S. 43 f. 2. Die deutsche Zwischenkriegszeit und ihre Sicherheitslage 145 Spiel“652 zu einer „massiven Prestigesteigerung, hatte doch Hitlers Aktion erneut einen Teil des Versailler Traumas gelöscht“653. Angesichts dieser außenpolitischen Erfolge sowie zweier im Oktober 1936 mit Italien und Japan abgeschlossener Bündnisse sah Adolf Hitler nun die Zeit gekommen, seine Langzeitstrategie der gewaltsamen Erweiterung des Herrschaftsraumes des deutschen Volkes umzusetzen, so dass er am 5. November 1937 seine führenden Militärs darüber in Kenntnis setzte, dass er zum Krieg entschlossen sei und dabei zunächst eine Annexion Österreichs und der Tschechoslowakei anstrebte.654 Der ‚Anschluss‘ Österreichs erfolgte wenige Monate später, als nach einem inszenierten Staatsstreich durch die österreichischen Nationalsozialisten am 12. März 1938 die deutsche Wehrmacht in Österreich einmarschierte und dort von der Bevölkerung begeistert empfangen wurde.655 Die übrigen europäischen Großmächte akzeptierten auch diesen Schritt zur „Schaffung eines Großdeutschlands“656, so dass sich Adolf Hitler nun der Tschechoslowakei zuwenden konnte. Hier konnte er zwar wegen der bestehenden Bündnisse der Tschechoslowakei mit Frankreich und der Sowjetunion nicht unmittelbar einmarschieren, allerdings verlangte er unter Berufung auf das nationale Selbststimmungsrecht die Annexion der sudentendeutschen Gebiete, die ihm schließlich am 29. September 1938 im so genannten ‚Münchner Abkommen‘ von Großbritannien, Frankreich und Italien gewährt wurde. Die tschechoslowakische Regierung, die an diesen Verhandlungen nicht beteiligt wurde, erhielt im Gegenzug allerdings eine Garantie dieser Großmächte gegen nicht provozierte Angriffe.657 Nach diesem Schritt umfasste das Deutsche Reich im Herbst 1938 nahezu alle deutschsprachigen Gebiete in Europa, und Adolf Hitler stand infolgedessen „auf einem Höhepunkt seiner Macht und Popularität. Auf revisionistischem Gebiet hatte er erreicht, wovon die Mehrzahl der Politiker und 652 Wildt, Geschichte des Nationalsozialismus, S. 137. 653 Wehler, Der Nationalsozialismus, S. 87. 654 Vgl. Brechtken, Die nationalsozialistische Herrschaft, S. 136 f.; Herbst, Das nationalsozialistische Deutschland, S. 177ff. und S. 184ff.; Wildt, Geschichte des Nationalsozialismus, S. 138 f. 655 Vgl. Bauer, Nationalsozialismus, S. 313ff.; Evans, Das Dritte Reich, S. 781ff.; Bernecker, Europa zwischen den Weltkriegen, S. 95 f. 656 Evans, Das Dritte Reich, S. 772. 657 Vgl. Thamer, Der Nationalsozialismus, S. 307ff.; Wildt, Geschichte des Nationalsozialismus, S. 140ff.; Evans, Das Dritte Reich, S. 805ff.; Herbst, Das nationalsozialistische Deutschland, S. 192ff. III. Historische Grundlagen 146 der Bevölkerung in Deutschland seit 1919 geträumt hatte – und er hatte es ohne Krieg erreicht.“658 Die Bilanz seiner Außenpolitik bis zu diesem Zeitpunkt fasst Magnus Brechtken folgendermaßen zusammen: „Wer nun als Deutscher nach sechs Jahren Hitlerscher Außenpolitik ohne moralische Wertung auf die Gestalt des Reiches blickte, der konnte leicht dem Eindruck verfallen, dass hier anscheinend ein begnadeter Politiker all jene Träume von großdeutscher Herrlichkeit erfüllt hatte, die historisch allen seinen Vorgängern stets versagt geblieben waren. Sofern sie nicht zu den verfolgten Minderheiten gehörten, konnten die meisten Deutschen die vergangenen Jahre des ‚Dritten Reiches‘ rückblickend als eine Phase lang ersehnter Stabilität und stetiger Erfolge interpretieren.“659 Allerdings deutet Magnus Brechtkens Hinweis auf die verfolgten Minderheiten an, dass man auch in diesen ‚guten‘ Jahre des Nationalsozialismus das „‚hässliche Gesicht‘ der Diktatur in Gestalt der sich radikalisierenden Judenverfolgung und permanenten Unterdrückung jeder Opposition“660 erkennen konnte. Gleichwohl war ab dem Herbst 1934 im Vergleich zu den beiden vorhergehenden Jahren zunächst ein deutlicher Rückgang des ‚offenen‘ nationalsozialistischen Terrors gegen politisch Andersdenkende und Juden und eine stärkere Bezugnahme auf Gesetz und Ordnung feststellbar661, der allerdings nicht darüber hinweg täuschen darf, dass „[h]inter der Fassade des Ordnungsstaates […] das System des außernormativen, mit der politischen Polizei verschmolzenen SS-Imperiums aus[gebaut wurde]“.662 Dabei entwickelte sich die von Heinrich Himmler geleitete SS zum wichtigsten Organ des politischen Terrors.663 Seine Ernennung zum ‚Reichsführer-SS und Chef der Deutschen Polizei‘ am 17. Juni 1936 führte schließlich zur Vereinnahmung der Polizei durch die SS, so dass diese die „Alleinzuständigkeit für die ‚innere Sicherheit‘“ erlangte und zum „Inbe- 658 Wehler, Der Nationalsozialismus, S. 57. 659 Brechtken, Die nationalsozialistische Herrschaft, S. 136 f. 660 Thamer, Der Nationalsozialismus, S. 179. 661 Vgl. Frei, Der Führerstaat, S. 136. 662 Vgl. Benz, Konsolidierung und Konsens, S. 51 f. (Zitat: S. 52). 663 Vgl. Herbst, Das nationalsozialistische Deutschland, S. 82ff.; Thamer, Der Nationalsozialismus, S. 199ff.; Bernecker, Europa zwischen den Weltkriegen, S. 82 f.; Hehl, Nationalsozialistische Herrschaft, S. 18 f.; Brechtken, Die nationalsozialistische Herrschaft, S. 98ff. 2. Die deutsche Zwischenkriegszeit und ihre Sicherheitslage 147 griff nationalsozialistischer Willkürherrschaft“664 bzw. zum „Instrument[en] der inneren Kriegführung“665 wurde, das „[a]n keine gesetzlichen Vorschriften gebunden und nur dem ‚Führer‘ verantwortlich, […] uneingeschränkt über Leben und Freiheit der Menschen in Deutschland [… bestimmte]“666. Der Rückgang des offenen politischen Terrors ab dem Herbst 1934 war nicht zuletzt darauf zurückzuführen, dass es der NSDAP zuvor gelungen war, die politische Opposition nahezu komplett zu zerschlagen, und dass der hocheffiziente NS-Verfolgungsapparat sowie die Loyalität und Begeisterung für den Nationalsozialismus in weiten Teilen der Bevölkerung fast keinen Spielraum für politischen Widerstand ließen. Die Anhänger der SPD und KPD waren durch Verhaftungswellen und Emigration so stark dezimiert, dass sie bis auf die äußerst riskante Verbreitung von Flugschriften, die zum Sturz des Hitler-Regimes aufriefen, kaum in Erscheinung traten.667 Ab 1935 und vor allem nach den Olympischen Spielen in Berlin im Sommer 1936 verlagerte sich daher der nationalsozialistische Terror vom weitgehend besiegten politisch-ideologischen Gegner zunehmend auf so genannte ‚Gemeinschaftsfremde‘, d. h. auf Personen, die sich insbesondere aus religiös-weltanschaulichen Gründen dem totalen Verfügungsanspruch des Regimes verweigerten oder aus rassisch-erbbiologischen Gründen die Reinheit des deutschen ‚Volkskörpers‘ gefährdeten.668 Hierzu gehörten neben den Juden, die ohne jeden Zweifel am stärksten von den Nationalsozialisten entrechtet, ausgegrenzt und verfolgt wurden, auch Sinti und Roma, Homosexuelle, Zeugen Jehovas, sich regimekritisch äußernde Anhänger anderer Kirchen, psychisch Kranke, geistig und körperlich Behinderte sowie die kaum genauer abgrenzbaren und nahezu willkürlich definierbaren ‚Gewohnheitsverbrecher‘, ‚Arbeitsscheue‘ und ‚Asoziale‘669, 664 Hehl, Nationalsozialistische Herrschaft, S. 18. 665 Frei, Der Führerstaat, S. 147. 666 Bernecker, Europa zwischen den Weltkriegen, S. 82. 667 Vgl. Frei, Der Führerstaat, S. 136 f.; Bernecker, Europa zwischen den Weltkriegen, S. 87 f.; Brechtken, Die nationalsozialistische Herrschaft, S. 88 f.; Evans, Das Dritte Reich, S. 105ff. 668 Vgl. Pohl, Verfolgung und Massenmord, S. 16; Wildt, Geschichte des Nationalsozialismus, S. 109 f.; Evans, Das Dritte Reich, S. 108ff.; Bernecker, Europa zwischen den Weltkriegen, S. 87; Brechtken, Die nationalsozialistische Herrschaft, S. 90ff.; Hehl, Nationalsozialistische Herrschaft, S. 22ff.; Wehler, Der Nationalsozialismus, S 129 f. 669 Vgl. W. Ayaß, Bettler und soziale Außenseiter im Nationalsozialismus, in: A. Allex, D. Kalkan [Hrsg.], ausgesteuert – ausgegrenzt … angeblich asozial, Neu- Ulm 2009, S. 21ff. III. Historische Grundlagen 148 zu denen oftmals Bettler, Obdachlose oder auch Wanderarbeiter gezählt wurden. Diese konnten jederzeit verhaftet und in Konzentrationslagern interniert werden, wo sie misshandelt und teilweise auch ermordet wurden, teilweise drohte ihnen auch gemäß dem ‚Gesetz zur Verhütung erbkranken Nachwuchses‘ vom 14. Juli 1933 die Zwangssterilisierung.670 Im Mittelpunkt des nationalsozialistischen Terrors stand aber zweifelsohne die jüdische Bevölkerung, deren Ausgrenzung und Verfolgung bereits wenige Monate nach der nationalsozialistischen Machtübernahme mit den ‚Aprilgesetzen‘ von 1933, die die Juden aus der Verwaltung, dem Bildungswesen, dem Gesundheitswesen und der Justiz entfernen sollte, begann.671 Im Anschluss daran folgten zahlreiche weitere, diskriminierende, rechtliche wie administrative Maßnahmen, wie z. B. Badeverbote in Badeanstalten, und Boykottaktionen gegen jüdische Geschäfte sowie die Stigmatisierung von Liebesbeziehungen zwischen Juden und Ariern als ‚Rassenschande‘672. Ludolf Herbst geht für den Zeitraum zwischen ‚Machtergreifung‘ und Kriegsbeginn von etwa 1.440 antisemitischen Maßnahmen insgesamt, d. h. durchschnittlich fast 20 pro Monat, aus.673 Am 15. September 1935 wurden dann das ‚Reichsbürgergesetz‘ und das ‚Gesetz zum Schutze des deutschen Blutes und der deutschen Ehre‘ – die so genannten ‚Nürnberger Gesetze‘ – beschlossen, die Juden zu Staatsbürgern zweiter Klasse degradierten und ihnen nicht nur die Eheschließung, sondern auch den außerehelichen Geschlechtsverkehr mit Ariern untersagten.674 Die dazugehörigen Ausführungsverordnungen führten zu immer weitergehen- 670 Vgl. Evans, Das Dritte Reich, S. 108ff.; Hehl, Nationalsozialistische Herrschaft, S. 23; Wildt, Geschichte des Nationalsozialismus, S. 110ff.; Pohl, Verfolgung und Massenmord, S. 12ff. 671 Vgl. Herbst, Das nationalsozialistische Deutschland, S. 77 f.; Frei, Der Führerstaat, S. 66 f.; Wildt, Geschichte des Nationalsozialismus, S. 118ff.; Thamer, Der Nationalsozialismus, S. 165ff. und S. 212ff.; Hehl, Nationalsozialistische Herrschaft, S. 7; Wehler, Der Nationalsozialismus, S. 137 f. 672 Vgl. A. Przyrembel, Rassenschande – Ein Begriff und seine Geschichte, in: W. Benz [Hrsg.], Handbuch des Antisemitismus – Judenfeindschaft in Geschichte und Gegenwart, Bd. 3: Begriffe, Theorien, Ideologien, München 2010, S. 273ff.; A. Przyrembel, Rassenschande – Reinheitsmythos und Vernichtungslegitimation im Nationalsozialismus, Göttingen 2003, S. 63ff. 673 Vgl. Herbst, Das nationalsozialistische Deutschland, S. 200; J. Walk, D. C. Brecher, B. Freundlich, Y. K. Jacoby, H. I. Weiss, R. M. W. Kempner, A. Rückerl, [Hrsg.], Das Sonderrecht für die Juden im NS-Staat – Eine Sammlung der gesetzlichen Maßnahmen und Richtlinien, Heidelberg 1981, S. 3ff.; Przyrembel, Rassenschande, S. 127ff. 674 Vgl. Brechtken, Die nationalsozialistische Herrschaft, S. 102ff.; Wildt, Geschichte des Nationalsozialismus, S. 116ff.; Bauer, Nationalsozialismus, 2. Die deutsche Zwischenkriegszeit und ihre Sicherheitslage 149 den Verschärfungen der Diskriminierung der jüdischen Bevölkerung, so dass diese mitten in den ‚guten‘ Jahren des Dritten Reiches beschlossenen Gesetze „die Grundlage aller weiteren antisemitischen Maßnahmen bis hin zur ‚Endlösung‘“ bildeten.675 Gleichwohl handelte es sich dabei – mit Ausnahme von vereinzelten Gewaltakten gegen Juden auf der lokalen Ebene676 – zu diesem Zeitpunkt im Wesentlichen noch um eine rechtliche und ökonomische Diskriminierung. Ab dem Herbst des Jahres 1938 fand dann aber eine weitere, sehr deutliche Radikalisierung der Politik der Dritten Reiches in der Weise statt, dass die rassistisch-ideologische Dimension des Nationalsozialismus und damit die Lösung der ‚Judenfrage‘ in der Innenpolitik und des ‚Raumproblems‘ in der Außenpolitik noch deutlicher als zuvor in den Mittelpunkt von Adolf Hitlers Plänen rückten.677 Die Radikalität und Kompromisslosigkeit, mit der das nationalsozialistische Regime an diese Themen ab Herbst 1938 heranging, verdeutlichte, dass das Dritte Reich an einem „Wendepunkt“ angekommen war und die Konsolidierungsphase nun in eine Phase der Radikalisierung übergegangen war, die fast zwangsläufig innerhalb von kurzer Zeit in einen Krieg münden würde.678 Die innenpolitische Radikalisierung spiegelte sich insbesondere im rasanten Anstieg des Häftlingsbestandes in den Konzentrationslagern wider. Waren im November 1936 nur noch ca. 4.700 Personen in Konzentrationslagern inhaftiert gewesen, so stieg diese Zahl bis Anfang November 1938 zunächst auf ca. 24.000 an, bevor dann innerhalb weniger Tage weitere 36.000 Inhaftierungen erfolgten679, so dass Norbert Frei bezeichnenderweise von einer „Auffüllung der Konzentrationslager“680 spricht. Ursächlich für den ersten Anstieg um ca. 20.000 Insassen waren vor allem mehrere Verhaftungswellen in der ersten Hälfte des Jahres 1938, bei denen auf Anordnung von Heinrich Himmler eine grob vorgegebene Zahl an ‚Arbeitsscheuen‘ und ‚Asozialen‘ sowie alle männlichen Juden, die mit einer S. 295ff.; Wehler, Der Nationalsozialismus, S. 138 ff.; Herbst, Das nationalsozialistische Deutschland, S. 150ff. Thamer, Der Nationalsozialismus, S. 214ff.; Bernecker, Europa zwischen den Weltkriegen, S. 91 f. 675 Bauer, Nationalsozialismus, S. 299. 676 Vgl. Pohl, Verfolgung und Massenmord, S. 12. 677 Vgl. Frei, Der Führerstaat, S. 148 f. 678 Vgl. H. A. Strauss, The Drive for War and the Pogroms of November 1938: Testing Explanatory Models, in: Leo Baeck Institute Yearbook, 35. Jg. (1990), S. 267ff.; Frei, Der Führerstaat, S. 148; Evans, Das Dritte Reich, S. 731. 679 Vgl. Wildt, Geschichte des Nationalsozialismus, S. 121. 680 Frei, Der Führerstaat, S. 144. III. Historische Grundlagen 150 Haftstrafe vorbestraft waren, was schon bei geringsten Delikten möglich war, zu inhaftieren waren. Die Inhaftierungen erfolgten zum einen aus ökonomischen Gründen, da die Verhafteten als Zwangsarbeiter eingesetzt werden sollten, zum anderen aber auch aus rassistisch-ideologischen Gründen, um diese Personen aus dem deutschen ‚Volkskörper‘ auszusondern.681 Einer der angesprochenen, massiven Anstiege der Häftlingszahlen in den Konzentrationslagern war auf die so genannte ‚Reichspogromnacht‘ zurückzuführen.682 Hierbei initiierte der Reichsminister für Volksaufklärung und Propaganda Joseph Goebbels am 9. November 1938 – vermutlich auf direkte Anordnung Adolf Hitlers – anlässlich der Ermordung eines deutschen Botschaftsangehörigen in Paris durch einen Juden deutschlandweite gewaltsame Aktionen gegen jüdische Einrichtungen und Geschäfte, die insbesondere durch die SA und die SS ausgeführt wurden, an denen sich aber auch zahlreiche weitere Personen beteiligten. Es kam in der folgenden Nacht zur Plünderung und Verwüstung von Tausenden von jüdischen Geschäften und Wohnhäusern, nahezu alle Synagogen wurden verbrannt oder auf andere Art und Weise zerstört, Tausende Juden wurden öffentlich gedemütigt und misshandelt, mindestens 90 bis 100 sogar ermordet. Anschließend erfolgte die Verhaftung von 20.000 bis 30.000 vermögenden, nicht zu alten, männlichen Juden. Das in diesen Pogromen gezeigte Ausmaß an Gewalt bis hin zur Mordbereitschaft stellte eine „unmissverständliche offene Kriegserklärung“683 an die jüdische Bevölkerung dar, die zusammen mit der in den folgenden Monaten forcierten Enteignung jüdischen Vermögens und ‚Arisierung‘ jüdischer Betriebe zu dem in Abbildung 4 dargestellten Anstieg der ohnehin hohen jüdischen Emigration führte.684 681 Vgl. Evans, Das Dritte Reich, S. 107ff.; Wildt, Geschichte des Nationalsozialismus, S. 120 f; Frei, Der Führerstaat, S. 142ff. 682 Vgl. Wildt, Geschichte des Nationalsozialismus, S. 126ff.; Herbst, Das nationalsozialistische Deutschland, S. 206ff.; Thamer, Der Nationalsozialismus, S. 219ff.; Pohl, Verfolgung und Massenmord, S. 16 f.; Evans, Das Dritte Reich, S. 702ff. 683 Wehler, Der Nationalsozialismus, S. 141. 684 Vgl. W. Benz [Hrsg.], Lexikon des Holocaust, München 2002, S. 61ff. Vgl. auch Herbst, Das nationalsozialistische Deutschland, S. 210ff. 2. Die deutsche Zwischenkriegszeit und ihre Sicherheitslage 151 Jüdische Emigration aus Deutschland 1933-1939 Lebten Mitte des Jahres 1933 noch ca. 750.000 Juden in Deutschland, Österreich und dem Sudentenland, so sank diese Zahl bis Mitte des Jahres 1939 auf ca. 330.000. In Bezug auf das ‚Altreich‘ sank diese Zahl von ca. 500.000 im Jahr 1933 auf etwa 190.000 Ende des Jahres 1939.685 „Gleichwohl hatte damit mehr als ein Drittel der jüdischen Deutschen auch nach sechs Jahren NS‑Herrschaft, trotz aller Verfolgungen und Einschüchterungsversuche, trotz aller politischen Entrechtung, wirtschaftlichen Verarmung und gesellschaftlichen Ächtung, trotz aller staatlichen und juristischen Diskriminierung, die Hoffnung nicht aufgegeben, in ihrer angestammten Heimat überleben zu können“.686 Allerdings zeigte sich bald, dass diese Hoffnung nicht gerechtfertigt war und dass die nationalsozialistische Judenpolitik „[i]m Schatten des Krieges […] die Form des systematischen Massenmordes“687 annehmen sollte. Dass im Herbst 1938 auch auf dem Gebiet der Außenpolitik eine deutliche Radikalisierung bevorstand, zeigte sich in der immer deutlicher erkennbaren Bereitschaft des NS-Regimes, militärische Mittel gegen die Tschechoslowakei einzusetzen. Am 21. Oktober 1938 erteilte Adolf Hitler Abb. 4: 685 Vgl. Brechtken, Die nationalsozialistische Herrschaft, S. 114ff.; Bauer, Nationalsozialismus, S. 338; Herbst, Das nationalsozialistische Deutschland, S. 211 und S. 213; Wehler, Der Nationalsozialismus, S. 143. 686 Brechtken, Die nationalsozialistische Herrschaft, S. 116. 687 Wildt, Geschichte des Nationalsozialismus, S. 131. III. Historische Grundlagen 152 schließlich dem Oberkommando der Wehrmacht den Befehl, die Zerschlagung der ‚Rest-Tschechei‘ und die Besetzung des Memellandes vorzubereiten.688 Umgesetzt wurden diese Vorhaben fünf Monate später in einem militärischen Drohszenario, aber ohne kriegerische Auseinandersetzungen. Am 14. März 1939 marschierte die deutsche Wehrmacht nach der von Adolf Hitler inszenierten Sezession der Slowakei und einem entsprechenden Hilferuf des slowakischen Regierungschefs sowie eines mit der Androhung eines Luftangriffs auf Prag vom tschechoslowakischen Präsidenten erpressten Abkommens in die Tschechoslowakei ein, besetzte die tschechischen Landesteile und wies ihnen einen Tag später als Reichsprotektorat Böhmen und Mähren einen halbkolonialen Status zu. Wiederum eine Woche später wurde am 22. März 1939 die Abtretung des Memellandes durch Litauen an das Deutsche Reich vereinbart.689 Die Reaktionen des Auslands und insbesondere Großbritanniens und Frankreich auf diese Entwicklungen verdeutlichten, dass die bisherige Beschwichtigungspolitik der Westmächte nicht mehr haltbar war. Ließ sich die Besetzung des überwiegend von Deutschen bewohnten Memellandes noch mit dem nationalen Selbstbestimmungsrecht begründen, so galt dies aber keinesfalls für die Besetzung Tschechiens.690 Angesichts dieses von Adolf Hitler vorsätzlich herbeigeführten Bruchs des ‚Münchner Abkommens‘, der der Weltöffentlichkeit den aggressiv-expansiven Charakter der nationalsozialistischen Außenpolitik deutlich vor Augen führte, erklärten Großbritannien und Frankreich im April 1939 ihre Bereitschaft, der immer stärker unter deutschen Druck geratenden polnischen Regierung im Fall eines deutschen Angriffs militärisch beizustehen.691 Das Hitler-Regime strebte insbesondere eine Wiedereingliederung der Freien Stadt Danzig ins Deutsche Reich sowie zunächst ein gegen die Sowjetunion gerichtetes deutsch-polnisches Bündnis an. Da die polnische Regierung diesen Vorschlägen nicht zustimmte, beschloss Adolf Hitler, Polen bei nächstbester 688 Vgl. Herbst, Das nationalsozialistische Deutschland, S. 192ff. und S. 218; Bauer, Nationalsozialismus, S. 339; Brechtken, Die nationalsozialistische Herrschaft, S. 147 und S. 149. 689 Vgl. Bauer, Nationalsozialismus, S. 340ff.; Thamer, Der Nationalsozialismus, S. 316 f.; Evans, Das Dritte Reich, S. 826ff.; Bernecker, Europa zwischen den Weltkriegen, S. 96 f. 690 Vgl. Herbst, Das nationalsozialistische Deutschland, S. 220; Wehler, Der Nationalsozialismus, S. 1161 f. 691 Vgl. Frei, Der Führerstaat, S. 149; Brechtken, Die nationalsozialistische Herrschaft, S. 149; Bauer, Nationalsozialismus, S. 343; Hildebrand, Geschichte des Dritten Reiches, S. 61 f. 2. Die deutsche Zwischenkriegszeit und ihre Sicherheitslage 153 Gelegenheit militärisch anzugreifen und teilte dies am 23. Mai 1939 auch der Spitze der Wehrmacht mit.692 Zu diesem Zweck nahm das nationalsozialistische Regime Verhandlungen mit dem „bolschewistischen Feind“ auf, die am 23. September 1939 schließlich zur Unterzeichnung eines Nichtangriffspaktes führten, der in einem geheimen Zusatzprotokoll die Zerschlagung Polens und die Aufteilung Osteuropas zwischen Deutschland und der Sowjetunion vorsah.693 Damit „war der Krieg vorprogrammiert“694. Als das Deutsche Reich dann einen Woche später, am 1. September 1939, Polen ohne formale Kriegserklärung angriff, begann der Zweite Weltkrieg und endete die Zwischenkriegszeit. Kriminalität im Deutschland der Zwischenkriegszeit Auch wenn man davon ausgehen muss, dass der tatsächliche Aufgabenschwerpunkt der Polizei im Bereich der ordnungserhaltenden Tätigkeiten liegt695, während kriminalistische, der Verbrechensbekämpfung im engeren Sinne dienende Tätigkeiten eine deutlich geringere Rolle im Arbeitsalltag von Polizeibeamten spielen, und dass die Polizei zudem nur einen relativ geringen Einfluss auf die Kriminalitätsrate hat696, so steht doch außer Frage, dass die Kriminalität eine wesentliche Rahmenbedingung polizeilicher Arbeit darstellt. Dementsprechend ist es zweckmäßig, sich an dieser Stelle zunächst mit der quantitativen Entwicklung der Kriminalität als „Summe der von einer Gesellschaft bzw. einem Rechtssystem als besonders schädlich und strafbar erachteten devianten Verhaltensweisen bzw. rechtlich definierten Normverstöße“697 in der deutschen Zwischenkriegszeit zu beschäftigen, bevor im folgenden Kapitel dann die deutsche Polizei und ihr Handeln in den Mittelpunkt der Analysen rücken. 3. 692 Vgl. Bauer, Nationalsozialismus, S. 343ff.; Brechtken, Die nationalsozialistische Herrschaft, S. 150; Evans, Das Dritte Reich, S. 834ff.. 693 Vgl. Wildt, Geschichte des Nationalsozialismus, S. 143 f. (Zitat: S. 143); Herbst, Das nationalsozialistische Deutschland, S. 225ff.; Bernecker, Europa zwischen den Weltkriegen, S. 98. 694 Thamer, Der Nationalsozialismus, S. 322. 695 Vgl. Vgl. Reiner, The Politics of the Police, S. 141ff.; Bayley, What do the police do? S. 141; Kniesel, Staatsaufgabe Sicherheit, Grundgesetz und Polizei, S. 81ff. 696 Vgl. Reiner, The Politics of the Police, S. 158 f.; Banton, The police as peace officers, S. 132 f. 697 K. Härter, Kriminalität, in: A. Cordes, H.-P. Haferkamp, H. Lück, D. Werkmüller, R. Schmidt-Wiegand [Hrsg.], Handwörterbuch zur deutschen Rechtsgeschichte, Bd. 3, 2. Aufl., Berlin 2004, Sp. 271. III. Historische Grundlagen 154 Dabei ist allerdings zu beachten, dass Kriminalstatistiken auch heutzutage, unter Zugrundelegung von aktuellen Daten aufgrund der damit verbundenen methodischen Probleme – insbesondere der hohen ‚Dunkelziffer‘ an nicht zur Anzeige gebrachten Straftaten und der aus der Heterogenität des Datenmaterials resultierenden Schwierigkeiten bei der Aggregation von Daten zu Kriminalitätskennziffern – nur eine sehr begrenzte Aussagekraft haben.698 Dass diese methodischen Probleme bei historischen Daten verstärkt gelten, ist offensichtlich. Hinzu kommt, dass sich auch die gesellschaftlichen und rechtlichen Normen, auf denen die inhaltliche Abgrenzung des Kriminalitätsbegriffs basiert, offensichtlich im Laufe der Geschichte oft und deutlich geändert haben. Insofern ist Patrick Wagner zuzustimmen, dass Kriminalstatistiken weniger die tatsächlich ausgeführten kriminellen Handlungen und vielmehr „das Niveau des gesellschaftlichen Konfliktes, der unter dem Etikett ‚Kriminalität‘ zwischen Straftätern, Geschädigten und den Strafverfolgungsorganen geführt wird“699, messen und daher stets mit äußerster Vorsicht zu interpretieren sind. Abbildung 5 veranschaulicht die quantitative Entwicklung der rechtskräftig verurteilten Straftäter als Indikator für die Kriminalitätsentwicklung in Deutschland zwischen 1911 und 1939.700 Dabei zeigt sich, dass die Polizeiarbeit in den Anfangsjahren der Weimarer Republik durch einen enormen Anstieg der Kriminalität geprägt war, der sich sowohl in der Polizei- als auch in der Gerichtsstatistik widerspiegelte.701 Diese Zunahme der Kriminalität galt nicht nur im Vergleich zu den Kriegsjahren, deren Kriminalitätsrate offensichtlich nicht mit derjenigen in Friedenszeiten vergleich- 698 Vgl. W. Steffen, Kriminalität – Messung, Bewertung, Lagebilddarstellung, in: M. Kniesel, E. Kube, M. Murck [Hrsg.], Handbuch für Führungskräfte der Polizei – Wissenschaft und Praxis, Lübeck 1996, S. 546ff.; P. Wagner, Volksgemeinschaft ohne Verbrecher – Konzeptionen und Praxis der Kriminalpolizei in der Zeit der Weimarer Republik und des Nationalsozialismus, Hamburg 1996, S. 26ff. 699 Wagner, Volksgemeinschaft ohne Verbrecher, S. 26. 700 Vgl. Statistisches Reichsamt [Hrsg.], Statistisches Jahrbuch für das Deutsche Reich, Bd. 1941/42, Berlin 1943, S. 649. 701 Vgl. Bessel, Policing, S. 193 f.; Bessel, Militarisierung und Modernisierung, S. 339 f.; H. Reinke, »… hat sich ein politischer und wirtschaftlicher Polizeistaat entwickelt« – Polizei und Großstadt im Rheinland vom Vorabend des Ersten Weltkrieges bis zum Beginn der zwanziger Jahre, in: A. Lüdtke [Hrsg.], »Sicherheit« und »Wohlfahrt« – Polizei, Gesellschaft und Herrschaft im 19. und 20. Jahrhundert, Frankfurt a. M. 1992, S. 239 f.; Petzina, Abelshauser, Faust, Sozialgeschichtliches Arbeitsbuch III, S. 137; B. Wehner, Dem Täter auf der Spur – Die Geschichte der deutschen Kriminalpolizei, Bergisch Gladbach 1983, S. 55ff. 3. Kriminalität im Deutschland der Zwischenkriegszeit 155 bar ist, sondern auch zu den Jahren vor dem Krieg. So blieb die Anzahl der rechtskräftig verurteilten Straftäter zwar im Jahr 1919 noch ungefähr konstant bei fast 350.000, was vermutlich auf die Überforderung der Strafverfolgungsbehörden im turbulenten ersten Nachkriegsjahr zurückzuführen sein dürfte, um sich dann aber innerhalb eines Jahres auf ca. 610.000 fast zu verdoppeln und das Vorkriegsniveau zu übertreffen. Bis 1923 stieg die Verurteiltenzahl sogar auf mehr als 820.000 an, so dass sich für die von politischer Revolution, gewaltsamen Aufständen und Unruhen sowie hoher Arbeitslosigkeit und Inflation geprägten ‚frühen Krisenjahre der Republik‘ zwischen 1919 und 1923 insgesamt ein Zuwachs der Kriminalitätsrate von mehr als 135% ergibt, der trotz der oben angesprochenen, gebotenen Vorsicht bei der Interpretation von Kriminalstatistiken auf eine deutliche reale Zunahme der Kriminalität schließen lässt.702 In diesem Sinne stellt Richard Bessel fest: „Although the relationship between crime statistics and crime is notoriously difficult to pin down, it seems clear from available evidence that the painful birth of German democracy coincided with a frightening increase in lawbreaking”703. Im Mittelpunkt standen in diesen Anfangsjahren der Weimarer Republik – wie auch schon in den letzten Kriegsjahren – die Diebstahlskriminalität sowie die als Sammelkategorie für verschiedene Bagatelldelikte dienenden Übertretungen.704 Zudem sah sich die Polizei angesichts der materiellen Not eines Großteils der Bevölkerung mit Hungerkrawallen, Konsumentenprotesten, Plünderungen und Felddiebstählen konfrontiert, die nach dem Kriegsende eskalierten und Ausdrucksformen der Unzufriedenheit mit der Versorgungslage waren.705 Angesichts des spontanen und kurzlebigen Charakters solcher Massenphänomene und der Beteiligung von zahlreichen Frauen, Kindern und Jugendlichen waren die Möglichkeiten der Strafverfolgungsbehörden im Allgemeinen und der Polizei im Besonderen, diese zweifelsohne illegalen Aktivitäten zu verhindern, sehr be- 702 Vgl. Wagner, Volksgemeinschaft ohne Verbrecher, S. 31. 703 Bessel, Policing, S. 193. 704 Vgl. Wagner, Volksgemeinschaft ohne Verbrecher, S. 30ff.; Bessel, Militarisierung und Modernisierung, S. 331ff. 705 Vgl. K. Hartewig, »Eine sogenannte Neutralität der Beamten gibt es nicht« – Sozialer Protest, bürgerliche Gesellschaft und Polizei im Ruhrgebiet (1918-1924), in: A. Lüdtke [Hrsg.], »Sicherheit« und »Wohlfahrt« – Polizei, Gesellschaft und Herrschaft im 19. und 20. Jahrhundert, Frankfurt a. M. 1992, S. 307ff. III. Historische Grundlagen 156 grenzt. Bei entsprechenden Polizeieinsätzen kam es gelegentlich sogar zu verbaler und physischer Gewalt gegen „eine[r] fast chancenlose[n] Polizei“706, was den massiven Legitimitätsverlust der Polizei in diesen Anfangsjahren der Weimarer Republik verdeutlichte.707 Die relative Stabilisierung der Sicherheitslage in den ‚ruhigen Jahren der Republik‘ zwischen 1924 und 1929 spiegelt sich ebenfalls in Abbildung 5 wider. Wie man erkennen kann, sank die Anzahl der Verurteilten bereits 1924 deutlich um ca. 15% und dann 1925 um weitere ca. 17%, um mit ca. 575.000 ungefähr das Vorkriegsniveau zu erreichen und in den folgenden Jahren auch zu halten. 706 Hartewig, »Eine sogenannte Neutralität der Beamten gibt es nicht«, S. 310. 707 Vgl. Reinke, »… hat sich ein politischer und wirtschaftlicher Polizeistaat entwickelt«, S. 239. Rechtskräftig Verurteilte in Deutschland 1911-1939Abb. 5: 3. Kriminalität im Deutschland der Zwischenkriegszeit 157 Wegen Diebstahls Verurteilte 1921-1939 Der Kriminologe Franz Exner merkte hierzu im Jahr 1949 an, dass der „Stabilisierung der Mark […] auf dem Fuße die Stabilisierung der Kriminalität [folgte]“708. Wie Abbildung 6 verdeutlicht, war dies hauptsächlich auf einen massiven Rückgang der Diebstähle zurückzuführen.709 Hier sank die Zahl der rechtskräftig Verurteilten von fast 370.000 im Jahr 1923 auf ca. 95.000 im Jahr 1926, d. h. um fast 75% innerhalb von drei Jahren, was die bereits oben geäußerte These unterstreicht, dass Diebstahldelikte in einem engen Zusammenhang zur materiellen Not der Bevölkerung stehen und somit als „Notkriminalität“710 charakterisiert werden können. In den folgenden drei Jahren verharrte die Anzahl der Verurteilten in dieser Deliktgruppe weitgehend konstant, um dann in den ‚späten Krisenjahren der Republik‘ ab 1930 Jahren wieder moderat anzusteigen. In den anderen wesentlichen Deliktsgruppen lassen sich zwar in den ‚ruhigen Jahren‘ der Weimarer Republik ebenfalls Rückgänge bei den Verurteiltenzahlen feststellen, allerdings fanden diese bereits 1923 und 1924 statt, fielen in der Regel deutlich moderater aus und waren auch weniger Abb. 6: 708 F. Exner, Kriminologie, Berlin u. a. 1949, S. 83. 709 Vgl. Statistisches Reichsamt [Hrsg.], Statistisches Jahrbuch für das Deutsche Reich, Bd. 1924, S. 378; Bd. 1926, S. 439; Bd. 1927, S. 491; Bd. 1929, S. 478; Bd. 1931, S. 540; Bd. 1933, S. 533; Bd. 1935, S. 530; Bd. 1937, S. 592; Bd. 1939, S. 626; Bd. 1941/42, S. 650. 710 Wagner, Volksgemeinschaft ohne Verbrecher, S. 37. III. Historische Grundlagen 158 nachhaltig. Dies veranschaulicht beispielsweise die Entwicklung der Kriminalitätsrate bei Mord und Totschlag in Abbildung 7.711 Wegen Mordes und Totschlags Verurteilte 1921-1939 So fiel die Verurteiltenzahl bei diesen Delikten zunächst zwischen 1921 und 1923 recht deutlich um etwa ein Drittel von 626 auf 419, um ein Jahr später allerdings wieder auf 602 anzusteigen und ungefähr auf diesem Niveau weitere zwei Jahre zu verharren, bevor sie dann 1927 wieder zunächst auf ca. 509 und 1928 mit 407 Verurteilten sogar den niedrigsten Wert des gesamten Betrachtungszeitraums erreichte. Die allgemeine Stabilisierung der sozialen und ökonomischen Verhältnisse in den mittleren Jahren der Weimarer Republik schlug sich folglich nicht in der Statistik für diese Delikte nieder, was aber angesichts der Tatsache, dass es sich hierbei um sehr gravierende und daher nur geringe absolute Häufigkeiten aufweisende Gewaltverbrechen handelte, bei denen sich Täter und Opfer meistens bereits vor der Tat gekannt hatten (Beziehungsdelikte)712, auch wenig verwunderlich war. Abb. 7: 711 Vgl. Statistisches Reichsamt [Hrsg.], Statistisches Jahrbuch für das Deutsche Reich, Bd. 1924, S. 378; Bd. 1926, S. 439; Bd. 1927, S. 491; Bd. 1929, S. 478; Bd. 1931, S. 540; Bd. 1933, S. 533; Bd. 1935, S. 530; Bd. 1937, S. 592; Bd. 1939, S. 626; Bd. 1941/42, S. 650. 712 Vgl. H.-D. Schwind, Kriminologie – Eine praxisorientierte Einführung mit Beispielen, 22. Aufl., Heidelberg u. a. 2013, S. 404 f. 3. Kriminalität im Deutschland der Zwischenkriegszeit 159 Interessanterweise bietet die Kriminalstatistik allerdings auch bei anderen, weniger gravierenden und deutlich häufiger vorkommenden Verbrechen kaum Anhaltspunkte für einen Rückgang der Kriminalität bzw. eine Verbesserung der Sicherheitslage in den ‚ruhigen Jahren der Republik‘. So verdeutlicht Abbildung 8, dass beispielsweise die Anzahl der wegen Körperverletzung Verurteilten zwar in den Jahren 1923 und 1924 mit ca. 36.000 bzw. 35.500 um ca. 20% geringer ausfiel als noch im Jahr 1921, allerdings stieg diese Zahl dann bis 1926 wieder auf das Niveau von 1921 und verharrte auf diesem hohen Niveau bzw. stieg ab 1929 dann sogar weiter an.713 Dies verdeutlicht, dass die Jahre zwischen 1924 und 1929 in der Tat nur eine Phase der relativen Ruhe und Stabilität waren, die sich zwar im Vergleich zu den turbulenten und gewaltsamen frühen Krisenjahren der Weimarer Republik durch eine verbesserte Sicherheitslage auszeichnete, in der „die Kontinuität der Gewalt im kleinen aber keinesfalls abriß“.714 Wegen Körperverletzung Verurteilte 1921-1939Abb. 8: 713 Vgl. Statistisches Reichsamt [Hrsg.], Statistisches Jahrbuch für das Deutsche Reich, Bd. 1924, S. 378; Bd. 1926, S. 439; Bd. 1927, S. 491; Bd. 1929, S. 478; Bd. 1931, S. 540; Bd. 1933, S. 533; Bd. 1935, S. 530; Bd. 1937, S. 592; Bd. 1939, S. 626; Bd. 1941/42, S. 650. 714 Schumann, Politische Gewalt, S. 203. III. Historische Grundlagen 160 Dass diese Entwicklung aber nicht nur Gewaltverbrechen betraf, sondern auch gewaltlose Formen von Kriminalität, veranschaulicht Abbildung 9.715 Hier zeigt sich, dass die Zahl der wegen Betrugs verurteilten Straftäter zwischen 1921 und 1923 zunächst bei ca. 34.000 bzw. 32.000 weitgehend stabil blieb, um dann allerdings bis 1926 um mehr als 60% auf ca. 53.000 anzusteigen und auf diesem hohen Niveau bis Anfang der 1930er Jahre zu verharren. Ein ähnliches Bild ergab sich auch für diesen Zeitraum in Bezug auf die Zahl der für Sittlichkeitsverbrechen verurteilen Personen, die in Abbildung 10 dargestellt werden.716 Wegen Betrugs Verurteilte 1921-1939 Auch hier blieb die Verurteiltenzahl zwischen 1921 und 1923 bei ca. 3.700 bzw. 3.400 zunächst weitgehend konstant, bevor dann bis 1926 und ein deutlicher Anstieg um mehr als 80% auf ca. 6.400 stattfand, um dann in den folgenden Jahren bis 1929 wieder auf ca. 5.400 abzusinken, ohne aller- Abb. 9: 715 Vgl. Statistisches Reichsamt [Hrsg.], Statistisches Jahrbuch für das Deutsche Reich, Bd. 1924, S. 378; Bd. 1926, S. 439; Bd. 1927, S. 491; Bd. 1929, S. 478; Bd. 1931, S. 540; Bd. 1933, S. 533; Bd. 1935, S. 530; Bd. 1937, S. 593; Bd. 1939, S. 627; Bd. 1941/42, S. 651. 716 Vgl. Statistisches Reichsamt [Hrsg.], Statistisches Jahrbuch für das Deutsche Reich, Bd. 1924, S. 378; Bd. 1926, S. 439; Bd. 1927, S. 491; Bd. 1929, S. 478; Bd. 1931, S. 540; Bd. 1933, S. 533; Bd. 1935, S. 530; Bd. 1937, S. 592; Bd. 1939, S. 626; Bd. 1941/42, S. 650. 3. Kriminalität im Deutschland der Zwischenkriegszeit 161 dings auch nur annähernd wieder das niedrige Niveau der Jahre 1921 bis 1923 zu erreichen. Auch wenn die Ursachen für diesen deutlichen Anstieg der Betrugskriminalität und der Sittlichkeitsverbrechen in den mittleren Jahren der Weimarer Republik, der mit der Stabilisierung der ökonomischen und sozialen Verhältnisse in diesem Zeitraum kontrastiert, nicht eindeutig geklärt sind, so erscheint es plausibel anzunehmen, dass die gesellschaftliche Modernisierung in diesen Jahren und die zunehmende Komplexität der deutschen Wirtschaft hierbei eine wichtige Rolle gespielt haben dürften.717 Unter den gesellschaftlichen und ökonomischen Rahmenbedingungen der ‚Goldenen Zwanziger‘ boten sich mehr Gelegenheiten für Sittlichkeitsverbrechen und es entstanden neuartige Möglichkeiten des Betrugs, die sich wohl in der Kriminalstatistik widerspiegelten. Wendet man sich nun den ‚späten Krisenjahren der Republik‘ ab 1930 zu, die durch die Folgen der Weltwirtschaftskrise und ein hohes Maß an politischer Gewalt geprägt waren und Anfang 1933 schließlich mit dem Untergang der Republik endeten, so entsprach auch hier die Entwicklung der Kriminalität nicht den intuitiven Erwartungen. So zeigt schon die in Abbildung 5 dargestellte Entwicklung der gesamten Kriminalität, dass der zu erwartende deutliche Anstieg der Delikte Anfang der 1930er Jahre nicht stattfand, und auch eine Betrachtung der Deliktsgruppen Betrug in Abbildung 9 und Sittlichkeitsverbrechen in Abbildung 10 lässt nicht auf einen Anstieg der Kriminalität schließen. Erstaunlich ist insbesondere der in Abbildung 8 veranschaulichte Rückgang der wegen Körperverletzung verurteilten Personen von ca. 49.000 in den Jahren 1929 und 1930 um etwa ein Drittel auf ca. 32.500 im Jahr 1933, der angesichts der „Bürgerkriegsatmosphäre Anfang der dreißiger Jahre“718 und der hierfür verantwortlichen, äußerst gewaltsamen Konflikte zwischen den paramilitärisch organisierten ‚Kampfverbänden‘ des linken und rechten politischen Spektrums kaum nachvollziehbar ist und auf methodische Probleme der Kriminalstatistik – insbesondere auf eine geringe Bereitschaft, Straftaten anzuzeigen, und eine Überforderung bzw. von der Regierung bewusst betriebene Behinderung der Strafverfolgungsorgane719 – hindeutet. Lediglich bei Mord und Totschlag (Abbildung 7) und Diebstahl (Abbildung 6) lässt sich ein moderater Anstieg der Kriminalität Anfang 717 Vgl. Wagner, Volksgemeinschaft ohne Verbrecher, S. 32. 718 Vgl. Wirsching, Die Weimarer Republik, S. 105 f. (Zitat: S. 106). 719 Vgl. P. Leßmann-Faust, Gewalt und Gewaltmonopole – Parameter der „Inneren Sicherheit“ in der Weimarer Republik, in: M. Dinges, F. Sack [Hrsg.], Unsichere Großstädte? Vom Mittelalter bis zur Postmoderne, Konstanz 2000, S. 261 f. III. Historische Grundlagen 162 der 1930er Jahre nachweisen, wobei die letztgenannte Entwicklung erneut den engen Zusammenhang zwischen wirtschaftlicher Not und Diebstahldelikten veranschaulicht.720 Wegen Sittlichkeitsverbrechen Verurteilte 1921-1939 Zusammenfassend lässt sich folglich für die Weimarer Zeit festhalten, dass sich die Kriminalität in den verschiedenen Deliktsgruppen sehr unterschiedlich entwickelte. Ein klarer Zusammenhang zwischen der politischen, sozialen und ökonomischen Entwicklung in der Weimarer Republik und der Kriminalität ist nur im Bereich der Diebstahldelikte erkennbar, die erwartungsgemäß in den von ökonomischen Krisen und materieller Not geprägten ‚frühen Krisenjahren‘ bis 1923 sehr massiv und in den ‚späten Krisenjahren‘ ab 1930 immer noch deutlich höhere Werte aufwiesen als in den ‚ruhigen‘ Jahren dazwischen. In Bezug auf die anderen hier betrachteten Deliktsgruppen ist hingegen zum Teil eine weitgehend stabile Entwicklung, zum Teil aber auch ein Anstieg der Kriminalität feststellbar. Beschäftigt man sich schließlich mit der Entwicklung der Kriminalität im nationalsozialistischen Deutschland ab 1933, dann muss man bei einer oberflächlichen Betrachtung der Kriminalstatistik zunächst den Eindruck gewinnen, dass das von der „gleichgeschalteten Presse des Nationalsozialismus […] eifrig [gepflegte] Bild ständig sinkender Kriminalität, das sich bis Abb. 10: 720 Vgl. Wagner, Volksgemeinschaft ohne Verbrecher, S. 34ff. 3. Kriminalität im Deutschland der Zwischenkriegszeit 163 heute im deutschen Alltagsbewußtsein konserviert hat und in demselben neben den sprichwörtlichen Autobahnen auf der Habenseite der Diktatur des Völkermordes verbucht wird“721, durchaus zutreffend zu sein scheint. So deutet sowohl die in Abbildung 5 dargestellte Zahl der insgesamt rechtskräftig Verurteilten als die in den Abbildungen 7, 9 und 10 veranschaulichten Verurteiltenzahlen in den Deliktsgruppen Diebstahl, Körperverletzung und Betrug auf einen mehr oder weniger deutlichen Rückgang der Kriminalität ab 1933 bzw. 1934 im Vergleich zu den vorhergehenden Weimarer Jahren hin. Lediglich in der in Abbildung 7 dargestellten Entwicklung der Deliktsgruppe Mord und Totschlag – und hier insbesondere bei den Morden – ergibt sich zunächst ein moderater Anstieg im Jahr 1934, bevor sich die Zahl der Verurteilten dann ab 1935 wieder auf dem Niveau der Weimarer Zeit einpendelt. Insofern lässt sich zunächst festhalten, dass die Kriminalstatistik auf einen deutlichen Rückgang der Kriminalität in Deutschland nach der nationalsozialistischen Machtübernahme hindeutet. Allerdings ist zu bedenken, dass die bereits oben angesprochenen, ohnehin vorhandenen methodischen Probleme bei der Interpretation von Kriminalstatistiken für die Zeit des Nationalsozialismus in besonderem Maße gelten, weil sich die für die inhaltliche Abgrenzung des Kriminalitätsbegriffs relevanten, gesellschaftlichen und rechtlichen Normen ab 1933 stark veränderten. Auch wenn die Weimarer Verfassung und ihr Rechtssystem nach der nationalsozialistischen Machtübernahme formal in Kraft blieben, so wurden das Rechtsstaatsprinzip und die verfassungsmäßigen Grundrechte insbesondere über Notverordnungen, die rechtsfreie Räume schufen, in denen die SA, SS und die von den Nationalsozialisten kontrollierte Polizei willkürlich agieren konnten722, sowie durch die Erklärung von unbestimmten, emotionsbeladenen, ideologisch fundierten Elementen wie den ‚Führerwillen‘, den ‚Geist des Nationalsozialismus‘ oder das ‚gesunde Volksempfinden‘ zu Rechtsquellen723 faktisch außer Kraft gesetzt. Dass dies die Aussagekraft der offiziellen Kriminalstatistik erheblich mindert und einen sinnvollen Vergleich mit den Angaben für die Weimarer Zeit nahezu ausschließt, ist offensichtlich. Dies lässt sich gut am Beispiel der in Abbil- 721 Wagner, Volksgemeinschaft ohne Verbrecher, S. 214. 722 Vgl. Wehler, Der Nationalsozialismus, S. 58ff.; Bauer, Nationalsozialismus, S. 198ff.; Bernecker, Europa zwischen den Weltkriegen, S. 79; Herbst, Das nationalsozialistische Deutschland, S. 64. 723 Vgl. E. Ritter, Justiz und innere Verwaltung, in: W. Benz, H. Graml, H. Weiss [Hrsg.], Enzyklopädie des Nationalsozialismus, 3. Aufl., Stuttgart 1998, S. 85 f. und S. 92ff. III. Historische Grundlagen 164 dung 10 dargestellten Entwicklung der wegen Sittlichkeitsverbrechen verurteilten Personen veranschaulichen. So dürfte der enorme Anstieg der Verurteilten um ca. 360% von ca. 5.000 im Jahr 1932 auf ca. 23.000 im Jahr 1937 offensichtlich nicht auf eine entsprechende Zunahme ‚unsittlicher‘ Verhaltensweisen der Bevölkerung zurückzuführen sein, sondern auf eine strengere Rechtsprechung sowie eine veränderte Rechtslage, die sich beispielsweise in der feineren Aufschlüsselung dieser bis zum Jahr 1933 in der offiziellen Kriminalstatistik als Einzelposten geführten Deliktsgruppe in die Unterposten Blutschande, widernatürliche Unzucht, Unzucht mit Personen unter vierzehn Jahren, Notzucht, Kuppelei und Zuhälterei widerspiegelt.724 Die in der offiziellen Kriminalstatistik abgebildete und bis zum heutigen Tag im Alltagsbewusstsein erhaltene Vorstellung, dass die Kriminalität während der nationalsozialistischen Herrschaft deutlich gesenkt werden konnte, erscheint vor diesem Hintergrund sehr fraglich. Patrick Wagner stellt hierzu sehr treffend fest: „Damit ist bereits der entscheidende Einwand gegen alle offiziellen kriminalstatistischen Daten der Jahre nach 1933 benannt: In ihnen fehlte naturgemäß die staatlich organisierte Raub- und Mordkriminalität ebenso wie eine Fülle im Schatten dieser Politik verübter Individualtaten, etwa die Beraubung und Mißhandlung von Regimegegnern oder jüdischen Bürgern. Würden diese Taten einbezogen, ergäbe sich zweifellos für die NS-Zeit das Bild gegenüber der Weimarer Republik gewaltig steigender Kriminalität.“725 Plausibel und glaubwürdig ist sicherlich der erhebliche Rückgang der Diebstähle zwischen 1932 und 1939, auch wenn dieser vermutlich etwas geringer ausgefallen sein dürfte, als es der Rückgang der wegen Diebstahldelikten verurteilten Personen um fast 50% nahelegt. Gerade weil es keinen Anlass zu der Annahme gibt, dass sich die Definition des Diebstahls im Nationalsozialismus geändert oder sich Nationalsozialisten in besonderem Maße an Diebstählen beteiligt haben726, dürfte die Kriminalstatistik in 724 Vgl. z. B. Statistisches Reichsamt [Hrsg.], Statistisches Jahrbuch für das Deutsche Reich, Bd. 1937, S. 592. 725 Wagner, Volksgemeinschaft ohne Verbrecher, S. 214. 726 Die zahlreichen Fälle von faktischer Enteignung insb. jüdischen Vermögens durch das nationalsozialistische Regime, die sowohl nach heutigen als auch nach Weimarer Maßstäben als illegal eingestuft werden müssten, wären in die Deliktsgruppe ‚Raub und räuberische Erpressung‘ einzuordnen. 3. Kriminalität im Deutschland der Zwischenkriegszeit 165 diesem Deliktsfeld weitgehend korrekt sein.727 Angesichts der geringen Aussagekraft der unter den besonderen Rahmenbedingungen der nationalsozialistischen Herrschaft entstandenen, offiziellen Kriminalstatistik erscheint es aber geboten, auf eine weitergehende Interpretation der vorliegenden Daten für die Zeit des Nationalsozialismus und insbesondere auf Vergleiche mit der Kriminalstatistik der Weimarer Zeit zu verzichten. 727 Vgl. Wagner, Volksgemeinschaft ohne Verbrecher, S. 217 f. III. Historische Grundlagen 166 Die deutsche Polizei in der Zwischenkriegszeit Wie die bisherigen Ausführungen verdeutlicht haben, war die deutsche Zwischenkriegszeit durch Unruhen, Proteste, Aufstände, politische Gewalt und verschiedene Formen von Kriminalität, aber auch durch staatlich verordneten Terror geprägt, die zweifelsohne den staatlichen Herrschaftsanspruch und dessen Legitimität in Frage stellten und dementsprechend gewaltige Herausforderungen für die innere Sicherheit und damit für die Polizei als zentralen Träger des staatlichen Gewaltmonopols im Innern darstellten. Im Folgenden sollen diese Herausforderungen und die Art und Weise, wie die deutsche Polizei versuchte, diese zu meistern, analysiert werden. Dabei wird nicht nur die existierende geschichtswissenschaftliche Literatur zu diesem Themenfeld ausgewertet, sondern es werden zudem die in der Zeitschrift ‚Die Polizei‘ (ZDPol) zwischen November 1918 und September 1939 publizierten Beiträge analysiert. Da gerade diese letztgenannten Publikationen bisher noch nicht fokussiert und systematisch in der Literatur ausgewertet worden sind728, sollen auf diese Weise neue, fundierte und wertvolle Erkenntnisse über die Polizei als Instrument staatlicher Herrschaft in der deutschen Zwischenkriegszeit generiert werden. In erster Linie wird im Folgenden die preußische Polizei betrachtet, während die anderen deutschen Länder weniger intensiv behandelt werden. Dies ergibt sich nahezu zwangsläufig aus der Tatsache, dass der weit überwiegende Teil der zwischen 1918 und 1939 in der ZDPol publizierten Beiträge von Angehörigen der preußischen Polizeikräfte geschrieben wurde und schwerpunktmäßig Angelegenheiten der preußischen Polizei behandelte. Gleichwohl wurden auch Beiträge von Autoren aus anderen deutschen Ländern publiziert, die im Folgenden selbstverständlich ebenfalls ausgewertet werden. Anhaltspunkte darauf, dass sich die Entwicklung und die Probleme der Polizei in den kleineren deutschen Ländern deutlich von denjenigen der preußischen Polizei unterschieden, finden sich nicht. Da Preußen in der Zwischenkriegszeit das mit Abstand größte deutsche Land war und das preußische Polizeiwesen Modellcharakter für alle anderen deutschen Polizeibehörden hatte, erscheint eine solche regionale Schwerpunktsetzung durchaus gerechtfertigt und ist daher in der polizei- IV. 728 Vgl. Schmidt, Schützen und Dienen, S. 26. Zu einer der wenigen Ausnahmen vgl. Pannbacker, Die Polizei im Bild der ‚Polizei‘, S. 21ff. 167 historischen Forschung zur deutschen Zwischenkriegszeit nicht unüblich.729 Die nun folgende Analyse der politischen, gesellschaftlichen und institutionellen Herausforderungen der Polizei im Betrachtungszeitraum und der sich daraus ergebenden Konsequenzen für die Rolle der Polizei in der Gesellschaft orientiert sich zweckmäßigerweise an der bereits oben bei der Darstellung der historischen Grundlagen der deutschen Zwischenkriegszeit und ihrer Sicherheitslage gewählten Struktur. Dementsprechend beginnen die nun folgenden Analysen mit einer (1) Phase des Zusammenbruchs der Wilhelminischen und Neuaufbaus der Weimarer Polizei in den Jahren zwischen 1919 und 1923, an die sich (2) eine Modernisierungs-, Professionalisierungs- und Demokratisierungsphase zwischen 1924 und 1929 und (3) eine Phase der Stagnation und Kapitulation zwischen 1930 und 1932 anschließen, bevor schließlich (4) eine Phase der Entgrenzung und Ideologisierung in den Jahren des Nationalsozialismus zwischen 1933 und 1939 folgt. Dabei wird nicht nur die institutionelle Entwicklung der deutschen Polizei in der deutschen Zwischenkriegszeit dargestellt und erörtert, sondern es werden darüber hinaus auch die zentralen polizeilichen Aufgaben- und Handlungsfelder – insbesondere der Streifendienst, der Kriminal- und Ermittlungsdienst und die Bewältigung von polizeilichen Großlagen (z. B. Aufstände und Demonstrationen) – analysiert.730 Auf diese Weise soll in Einklang mit Alf Lüdtkes eher kulturwissenschaftlich geprägtem Ansatz, der Herrschaft als soziale Praxis versteht731, auch die in der polizeihistorischen Literatur bisher oft vernachlässigte konkrete, alltägliche Polizeiarbeit in den Analysefokus genommen werden. Zusammenbruch und Neuaufbau (1918-23) Für das deutsche Polizeiwesen stellte das Ende des Ersten Weltkriegs, der den Anfang der hier betrachteten Zwischenkriegszeit markierte, zweifels- 1. 729 Vgl. z. B. Knatz, Polizei in der Weimarer Republik, S. 38; Leßmann-Faust, Geschichte der Polizei, S. 10. 730 Vgl. D. H. Bayley, What do the police do? in: T. Newburn [Hrsg.], Policing: Key Readings, Cullompton 2005 (Erstveröffentlichung: 1994), S. 141ff.; M. Kniesel, Staatsaufgabe Sicherheit, Grundgesetz und Polizei, in: M. Kniesel, E. Kube, M. Murck [Hrsg.], Handbuch für Führungskräfte der Polizei – Wissenschaft und Praxis, Lübeck 1996, S. 80ff. sowie die Gliederung dieses Handbuchs (S. 4 f.). 731 Vgl. Lüdtke, Einleitung: Herrschaft als soziale Praxis, S. 13ff. IV. Die deutsche Polizei in der Zwischenkriegszeit 168 ohne einen markanten Wendepunkt dar.732 Dies lag nicht zuletzt daran, dass das Militär im Kaiserreich stets auch eine wichtige innenpolitische Pazifizierungsfunktion ausgeübt hatte und als „conditio sine qua non der Tätigkeit besonders der uniformierten Polizei“ galt.733 Dies galt erst recht seit dem Beginn des Ersten Weltkriegs, da in Kriegszeiten das Militär – zusammen mit den staatlichen und kommunalen Polizeibeamten in urbanen Räumen sowie den Gendarmen in ländlichen Regionen – auch formal die Polizeigewalt innehatte.734 Mit der vernichtenden Kriegsniederlage fiel dieser wichtige Pfeiler der deutschen Sicherheitsarchitektur in sich zusammen.735 Ohne militärische Unterstützung war die deutsche Polizei in den turbulenten Anfangsmonaten der Weimarer Republik nicht einmal ansatzweise in der Lage, die öffentliche Sicherheit und Ordnung aufrecht zu erhalten, so dass man von einem kompletten Zusammenbruch der Systems der inneren Sicherheit in Deutschland sprechen konnte. Zusammenbruch des Wilhelminischen Polizeisystems Nach der Ausrufung der Republik am 9. November 1918 verschwand der ‚pickelbehaubte‘ Schutzmann, der als Repräsentant monarchischer Macht fest im städtischen Straßenbild der Wilhelminischen Gesellschaft etabliert war, innerhalb weniger Tage nahezu vollständig.736 Dabei hatte sich bereits in den letzten beiden, von massiven Versorgungsengpässen geprägten Kriegsjahren angedeutet, dass die aufgrund der zahlreichen Einberufungen zunehmend aus älteren, oftmals reaktivierten Beamten bestehende Polizei kaum noch in der Lage war, den sozialen Frieden aufrecht zu erhalten. Als sich die personell ausgedünnte, in der Bevölkerung unbeliebte, durch die Kriegsniederlage tief verunsicherte und nicht mehr vom Militär gestützte deutsche Polizei Anfang November 1918 revolutionären Matrosen-, Soldaten- und Arbeiterverbänden gegenübersah, die ihre Entwaffnung sowie die a) 732 Vgl. Bessel, Policing, S. 188. 733 Leßmann-Faust, Geschichte der Polizei, S. 18. 734 Vgl. P. Leßmann-Faust, Weimarer Republik: Polizei im demokratischen Rechtsstaat am Beispiel Preußens, in: H.-J. Lange [Hrsg.], Staat, Demokratie und Innere Sicherheit in Deutschland, Opladen 2000, S. 30. 735 Vgl. Bessel, Policing, S. 189; Hartewig, »Eine sogenannte Neutralität der Beamten gibt es nicht«, S. 297ff.; Leßmann-Faust, Die Preußische Schutzpolizei, S. 20 f.; Liang, Die Berliner Polizei, S. 37ff. 736 Vgl. Leßmann-Faust, Die Preußische Schutzpolizei, S. 17; Schmidt, Schützen und Dienen, S. 64. 1. Zusammenbruch und Neuaufbau (1918-23) 169 Übergabe ihrer Dienstgebäude verlangten, ergab sie sich in der Regel rasch und ohne nennenswerten Widerstand. Viele Polizeibeamte kehrten zwar nach einigen Tagen – nach einer entsprechenden Aufforderung der neuen Regierung – wieder in den Dienst zurück, allerdings war der erlittene Autoritätsverlust kurzfristig nicht mehr rückgängig zu machen.737 Der nahezu vollständige Zusammenbruch der Wilhelminischen Polizei am 9. November 1918 sowie ihre ‚Lähmung‘ in den ersten Monaten der Republik und die tiefe Verunsicherung der Polizeibeamten spiegelten sich nicht zuletzt darin wider, dass die Beiträge in der ZDPol die eben geschilderten, umwälzenden Geschehnisse – insbesondere die Ausrufung der Republik, die damit einhergehenden Unruhen und die Entwaffnung der Polizei – zunächst einige Wochen lang ignorierten und erst am 19. Dezember 1918 an wenig prominenter Stelle, unter der Rubrik ‚Aus der deutschen Beamtenschaft‘ ein Beitrag erschien, der die Novemberrevolution von 1918 und ihre Folgen für das Land und insbesondere für die Polizei thematisierte.738 Der Aufsatz des Breslauer Polizeiinspektors und in den vorangegangenen und folgenden Jahren in dieser Zeitschrift sehr aktiven Autors Heinrich Eiben mit dem bezeichnenden Titel „Die Polizei-Exekutivbeamten der neuen Zeit“ begann mit der poetisch formulierten, die gewaltigen Umbrüche in der Gesellschaft wie auch der Polizei andeutenden Feststellung: „Aus den Ruinen der Vergangenheit möge segensreich die Zukunft erblühen. Dies ist wohl der innigste Wunsch aller Männer, die bisher im Dienste der hl. Hermandad739 pflichttreu ihre Aufgabe erfüllt und alle Kräfte eingesetzt haben, um ihren Mitmenschen zu dienen.“740 Bereits mit diesen ersten beiden Sätzen begann der Autor, die wichtige gesellschaftliche Rolle der Polizei sowohl in der Wilhelminischen Zeit als auch in der neuen Republik hervorzuheben, wobei er bezeichnenderweise nicht auf ihre Funktion als Instrument staatlicher Herrschaft oder Sicher- 737 Vgl. Buder, Die Reorganisation der preußischen Polizei, S. 20ff.; U. Kluge, Soldatenräte und Revolution – Studien zur Militärpolitik in Deutschland 1918/19, Göttingen 1975, S. 69 f.;. 738 Vgl. H. Eiben, Die Polizei-Exekutivbeamten der neuen Zeit, in: ZDPol, 15. Jg. (1918/19), Nr. 19 (19.12.1918), S. 329 f. 739 Der Begriff ‚Heilige Hermandad“ bezieht sich auf eine im 15. Jahrhundert in Kastilien gegründete Institution, die polizeiliche Funktionen übernahm und als Vorläufer der noch heute in Spanien bestehenden, militärisch geprägten Polizeibehörde ‚Guardia Civil‘ gilt; vgl. W. Brandis, Die „Santa Hermandad“, in: Archiv für Kulturgeschichte, 41. Jg. (1959), Nr. 3, S. 302ff. 740 Eiben, Die Polizei-Exekutivbeamten der neuen Zeit (19.12.1918), S. 329. IV. Die deutsche Polizei in der Zwischenkriegszeit 170 heitsorgan einging, sondern stattdessen betonte, dass die Polizei traditionell dazu da sei, „um ihren Mitmenschen zu dienen“, was angesichts des traditionell ziemlich autoritären, militärisch geprägten, auf ‚Befehl und Gehorsam‘ beruhenden Auftretens der Wilhelminischen Polizei gegenüber dem Bürger741 wenig überzeugend auf die Leserschaft wirken musste. Insofern ist wohl davon auszugehen, dass dies eher eine Wunschvorstellung des Autors als eine Beschreibung der Realität war. Anschließend erläuterte Heinrich Eiben, wie sich diese Rolle seiner Ansicht nach unter den neuen politischen Rahmenbedingungen entwickeln sollte. „Mit der Revolution ist nicht nur der preußische Militärstaat, sondern auch die alte Polizeiherrschaft zusammengebrochen. Ein freies Volk ist entstanden mit dem festen Willen, sich selbst zu regieren und vermöge seiner sittlichen Kräfte Ausschreitungen zum Nachteile anderer zu verhindern. Ein hohes Ziel. Es zu verwirklichen, ist der Wunsch jedes Deutschen. Keiner wird zurückstehen wollen, am wenigsten die Polizeibeamten. Das zeigen ihre Kundgebungen an allen Orten.“742 Auch wenn die hier angesprochenen Kundgebungen von Polizeibeamten in der übrigen Literatur keine Erwähnung finden, so dass durchaus Zweifel am Wahrheitsgehalt dieser Aussage angebracht erscheinen, und auch der Zusammenbruch des Kaiserreichs und die Ausrufung der Republik ganz gewiss nicht von allen Polizeibeamten begrüßt wurden, so darf die Tragweite der Tatsache, dass eine derart positive Einschätzung der Novemberrevolution 1918 in einer der führenden polizeinahen Fachzeitschriften von einem durchaus einflussreichen Polizeibeamten – dem späteren stellvertretenden Vorsitzenden der Vereinigung der höheren staatlichen Polizei- Exekutivbeamten Preußens und späteren Schriftleiter der als Beilage zu ‚Der Polizei‘ erscheinenden Zeitschrift ‚Führer der Polizeiexekutive‘743 – vertreten wurde, aber auch nicht unterschätzt werden. Bemerkenswert war vor allem sein Hinweis auf den Zusammenbruch des „preußische[n] Militärstaat[es]“ und der „alte[n] Polizeiherrschaft“ und die sich daraus ergebende Entstehung eines „freien Volk[es]“, der zwar die Funktion der Polizei als Instrument staatlicher Herrschaft hervorhob, diese zugleich aber für das Wilhelminische Deutschland delegitimierte, da die Menschen im Kaiser- 741 Vgl. Funk, Die Entstehung der Exekutivpolizei, S. 19ff. 742 Eiben, Die Polizei-Exekutivbeamten der neuen Zeit (19.12.1918), S. 329. 743 Vgl. z. B. o. V., Erster Jahresbericht der Vereinigung der staatlichen höheren Polizeiexekutivbeamten Preußens (e.V.), Sitz Hannover, in: Führer der Polizeiexekutive, Beilage zu der ZDPol, 17. Jg. (1920/21), Nr. 6 (10.6.1920), S. 134 und S. 136. 1. Zusammenbruch und Neuaufbau (1918-23) 171 reich nicht frei waren und die Polizei folglich eine ‚falsche‘ Herrschaft aufrechterhalten habe. Diese sehr deutliche Kritik an der Monarchie und an der früheren Rolle der Polizei hätte man zwar in einer Rede eines sozialdemokratischen Abgeordneten oder in einem Publikationsorgan des linken politischen Spektrums erwarten können, aber angesichts der traditionell konservativ-deutschnationalen Gesinnung der meisten Polizeibeamten744 sicherlich nicht in einem von einem einflussreichen Polizeibeamten geschriebenen, in einer führenden polizeilichen Fachzeitschrift publizierten Artikel. Auch im weiteren Verlauf dieses Artikels vertrat Heinrich Eiben sehr deutlich eine monarchiekritische, an demokratischen Werten orientierte Position und forderte die uneingeschränkte Unterstützung der Republik durch die Polizei. „Wie unser ruhmreiches Heer gegen eine Welt von Feinden, so haben wir Polizisten bis zur Erschöpfung für die alte Ordnung gekämpft. Mit ihrem Zerfall und mit der Einsicht, daß sie sich überlebt hatte und von der Mehrzahl unserer Volksgenossen eine neue Ordnung gefordert wurde, haben wir uns auf den Boden der Tatsachen gestellt, alle wie ein Mann. […] Des Polizisten Herz soll jedem gehören, ohne Rücksicht auf den Rang, Stand, Vermögen und politische Gesinnung. […] Die Befürchtung, wir würden am Alten kleben und nicht willig das neue mit auszubauen suchen, wird sich bald als grundlos ergeben.“745 Neben der an die im Wesentlichen aus Polizeibeamten bestehende Leserschaft gerichtete Aufforderung, die neue, republikanische Staatsordnung zu akzeptieren war insbesondere die im letzten Satz enthaltene Warnung, „am Alten [zu] kleben“ interessant. Eine solche ‚reaktionäre‘ Einstellung dürfte nämlich bei den Angehörigen der ehemaligen Schutzmannschaft und insbesondere im Polizeioffizierskorps746 durchaus weit verbreitet gewesen sein. So merkt Daniel Schmidt in diesem Zusammenhang an, „dass die Schutzleute die neue Ordnung nur mit in der Tasche geballter Faust und zusammengebissenen Zähnen akzeptierten. […] Die Ereignisse des Novembers 1918 als tiefe Demütigung empfindend, warteten die alten Kameraden auf die Chance, ihr angeschlagenes Prestige wiederherzustellen und es ihren ‚frechen‘ Überwindern heimzuzahlen.“747 744 Vgl. Schmidt, Schützen und Dienen, S. 65 f. 745 Eiben, Die Polizei-Exekutivbeamten der neuen Zeit (19.12.1918), S. 329 f. 746 Vgl. Leßmann-Faust, Die Preußische Schutzpolizei, S. 153ff. 747 Schmidt, Schützen und Dienen, S. 65 f. IV. Die deutsche Polizei in der Zwischenkriegszeit 172 Heinrich Eiben vertrat nun aber die Ansicht, dass eine solche Einstellung zwecklos und aus polizeilicher Sicht auch kontraproduktiv sei. Stattdessen befürwortete er, die neuen Machtverhältnisse zu akzeptieren und „willig das neue mit auszubauen“, damit eine Polizei entstehen konnte, die unter den politischen und rechtlichen Rahmenbedingungen der neuen Republik die öffentliche Sicherheit gewährleisten konnte. Am Ende des Beitrags wurde sogar explizit und – trotz eines wenig überzeugenden, das oftmals autoritative und diskriminierende Verhalten der früheren Kaiserlichen Schutzmannschaft als „nicht Absicht, sondern nur Gewohnheit“ beschönigenden Einschubs – erstaunlich deutlich die Rolle der Polizei im Wilhelminischen „Klassenstaat“ kritisiert und eine neue, weniger vom Standesdenken geprägte, bürgerorientiertere Form der Polizeiarbeit gefordert. „Unser früherer Staat war ein Klassenstaat […], der neue soll es nicht mehr sein. Ohne weiteres wird wohl zugegeben werden müssen, daß das Klassenwesen sich teilweise zu stark herausgebildet hatte und auch der Polizei-Exekutivbeamte bei Ausführung der Gesetze nicht unberührt davon geblieben ist. […] Nicht selten ist zuviel Rücksicht genommen worden auf die Besitzenden und Höhergestellten. Es wird nicht Absicht, sondern nur Gewohnheit gewesen sein. Dies muß aufhören. […] Mehr Fühlung mit dem Volksempfinden, mehr offenes Ohr für das oft recht gesunde Urteil der Untergebenen tut Not. […] Wir werden deshalb alle Kräfte einsetzen, um den neuen Ideen zum Siege zu helfen. Zu diesem Zwecke werden wir auch freudig kämpfen, niederhalten, was nicht mehr zeitgemäß, und aufrichten, was die Zukunft fordert, zum Wohle unsres aus so vielen Wunden blutenden deutschen Vaterlandes.“748 Gerade dieses abschließende Plädoyer für eine Unterstützung nicht nur der neuen Regierung, sondern auch der „neuen Ideen“, was die republikanische, auf demokratischen Werten basierende Verfassung der Weimarer Republik und die darin verankerten Versammlungs-, Vereinigungs- und Meinungsfreiheit sowie weitere Individualrechte meinte749, verdeutlichte, dass die Polizei in diesen Monaten um die Jahreswende 1918/19 keinesfalls uneingeschränkt als Relikt der Monarchie und Feind der neuen Ordnung betrachtet werden sollte, wie die oben zitierte Einschätzung von Daniel Schmidt andeutet. Dies belegt nicht zuletzt die Tatsache, dass der auch als ‚Schrader-Verband‘ bezeichnete, eindeutig demokratisch-republikanisch 748 Eiben, Die Polizei-Exekutivbeamten der neuen Zeit (19.12.1918), S. 330. 749 Vgl. Leßmann-Faust, Weimarer Republik, S. 38. 1. Zusammenbruch und Neuaufbau (1918-23) 173 orientierte ‚Verband preußischer Polizeibeamter‘ im Jahr 1919 bereits ca. 22.000 Mitglieder und im Jahr 1930 sogar ca. 75.000 Mitglieder aufwies.750 Die Polizei war zwar sicherlich auch kein ‚Hort‘ der Demokratie‚ aber es gab gut erkennbare Ansätze für eine gewisse Sympathie mit der neuen, demokratischen Staatsordnung. So konnte man in den ersten Monaten nach der Revolution in der ZDPol vergeblich nach Beiträgen suchen, die die Ausrufung der Republik beklagten oder eine Wiedereinsetzung des Kaisers forderten, wohingegen durchaus einige Beiträge erschienen, die deutlich machten, dass Teile der deutschen Polizei offensichtlich bereit waren, die bisherige Staatsform und die Rolle der Polizei darin kritisch zu hinterfragen, sich der neuen Staatsordnung und ihren sozialistisch-revolutionären Grundsätzen anzupassen und der neuen Staatsgewalt als Herrschaftsinstrument zu dienen. Einer dieser Beiträge war der im wenige Monate später, im Mai 1919, in dieser Zeitschrift erschienene Artikel des Polizeikommissars Wollenberg mit dem Titel „Die Beziehungen zwischen Politik und Polizei“.751 In diesem Beitrag erläuterte der Autor zunächst, dass es in den letzten Monaten öffentliche Forderungen nach einer neutralen, unpolitischen Rolle der Polizei gab, um anschließend festzustellen, dass eine solche Rolle seiner Einschätzung nach weder möglich noch sinnvoll sei. „Folglich ist und bleibt die Polizei das politische Werkzeug der Regierung. […] Undurchführbar ist daher die Forderung einer völlig unpolitischen Handhabung und Haltung der Polizei. Sie wird zum Widersinn, da sie mit dem Wesen der Polizei unvereinbar ist. Ein anderer Schluß aber ergibt sich aus dem Vorangeführten mit notwendiger Folgerichtigkeit: Wer eine Staatsregierung nicht anerkennt, kann deren Polizei nicht handhaben, noch Werkzeug ihrer Polizei sein.“752 Wie schon zuvor Heinrich Eiben trat auch Wollenberg uneingeschränkt dafür ein, dass die Polizei die neuen Machtverhältnisse akzeptieren und der neue Regierung dienen sollte. Dies ergebe sich zwangsläufig aus ihrer Funktion als „politische[s] Werkzeug der Regierung“. Damit bestätigte der Autor hier sehr eindrücklich die weiter oben im theoretischen Teil dieser Dissertation erarbeitete und sich im Titel widerspiegelnde Argumentation, dass die Polizei nicht primär als neutrales Sicherheitsorgan zum Schutz der 750 Vgl. Leßmann-Faust, Die Preußische Schutzpolizei, S. 142 f. 751 Vgl. Wollenberg, (Vorname fehlt), Die Beziehungen zwischen Politik und Polizei, in: ZDPol, 16. Jg. (1919/20), Nr. 4 (22.5.1919), S. 78 f. 752 Wollenberg, Die Beziehungen zwischen Politik und Polizei (22.5.1919), S. 78. IV. Die deutsche Polizei in der Zwischenkriegszeit 174 Bevölkerung, sondern als Instrument staatlicher Herrschaft im Sinne des konflikt- oder herrschaftstheoretischen Ansatzes der Polizeisoziologie zu sehen ist, das vorrangig bestimmten, partikulären Interessen – nämlich denen des jeweiligen Machthabers bzw. der jeweiligen Regierung – dient. Dabei ist hervorzuheben, dass Wollenberg hier nicht etwa nur die polizeiliche Unterstützung der Regierung in einem abstrakten Sinne forderte, die sich aus dem für Beamte geltenden besonderen Treue- und Gehorsamsverhältnis zum Staat bzw. der geforderten Loyalität zur Obrigkeit ergab.753 Wie seine weiteren Ausführungen verdeutlichten, meinte er durchaus ganz konkret die auf der Grundlage der Weimarer Verfassung demokratisch gewählte Regierung der Weimarer Republik als legitime Repräsentantin des Volkes. „Auf die Regierung kommt es an. Es ist Voraussetzung im demokratisch-sozialistischen Staat, daß sie die Verkörperung und das ausführende Werkzeug des souveränen Volkswillens ist. Dann haben die Beamten der Polizei die Pflicht, mit ihrer ganzen Person sich einzusetzen für die Durchführung des Volkswillens gegenüber einzelnen wie der widerstrebenden Minderheit. Vollstrecker des Gemeinschaftswillens an jedwedem Eigenwillen sollen sie sein. Sorge der Polizei muß es sein, daß der Wille des Volkes, der Regierung Geltung und Leben gewinnen, da, wie die Erfahrung lehrt, die befriedigende Wirkung ohne polizeiliche Durchführung oft genug ganz ausbleibt.“754 Der Autor sah die neue, demokratische Staatsform – wie auch Heinrich Eiben im zuvor betrachteten Beitrag – gerade für die Polizei als wesentlichen Fortschritt im Vergleich zur vorherigen Monarchie an, da sie zur Folge habe, dass der ‚Wille des Volkes‘ und derjenige der Regierung nunmehr identisch seien, so dass die Polizei zugleich Instrument staatlicher Herrschaft und Diener des Volkes sein konnte, ohne sich in Wiedersprüche zu verwickeln. Folglich spricht auch dieser Beitrag dafür, dass sich die Polizei in den ersten Monaten der Weimarer Republik durchaus kritisch mit ihrer Rolle als staatliches Herrschaftsinstrument sowohl im Kaiserreich als auch in der neuen Republik und den sich daraus ergebenden Implikationen auseinandersetzte. Dies war eine notwendige, aber keine hinreichende Bedingung, damit das bisherige, auf Kaisertreue, militärischen Umgangsformen und Autoritarismus beruhende Wilhelminische Polizeisystem nicht nur 753 Vgl. hierzu z. B. Bracher, Die Auflösung der Republik, S. 159 f. 754 Wollenberg, Die Beziehungen zwischen Politik und Polizei (22.5.1919), S. 79. 1. Zusammenbruch und Neuaufbau (1918-23) 175 aus dem deutschen Straßenbild755, sondern auch aus den ‚Köpfen‘ der Polizeibeamten verschwinden konnte, und eine Polizei entstehen konnte, die unter den neuen politischen Rahmenbedingungen erfolgreich als Instrument staatlicher Herrschaft fungieren konnte. Darüber hinaus verdeutlichte dieser Beitrag, dass es in den revolutionären ersten Monaten der Weimarer Republik nicht nur deutsche Polizeibeamte mit einer ausgesprochen positiven Haltung zur neuen demokratisch-republikanischen Staatsform und sogar zur sozialistischen Orientierung der neuen Regierung gab, sondern dass diese sich öffentlich zu Wort melden und ihre Meinung in einer der führenden polizeilichen Fachzeitschriften veröffentlichen konnten. Auf die Repräsentativität dieser Einstellungen und ihre politischen und polizeipraktischen Implikationen kann daraus aber nicht geschlossen werden. In diesem Zusammenhang ist insbesondere zu berücksichtigen, dass die Polizei in diesen ersten Monaten der Weimarer Republik keine wesentliche Rolle bei der Sicherung der öffentlichen Ordnung spielte. So stellt Peter Leßmann-Faust fest, dass „in der revolutionären Anfangsphase der Weimarer Republik bis Mitte 1919 […] das Gewaltmonopol in den Händen verschiedenster Sicherheitsorgane, aber nur zum geringsten Teil in den Händen der Polizei [lag]“756. Die Zuständigkeit im Bereich der inneren Sicherheit übernahmen vor allem die zunächst von den Arbeiter- und Soldatenräten und später auch von der bürgerlichen Bevölkerung gebildeten Sicherheitswehren, Arbeiterwehren, Soldatenwehren, Bürgerwehren, Einwohnerwehren, Wachregimenter, Sicherheitsregimenter oder Sicherheitskompanien.757 Dabei handelte es sich um nach dem Kriegsende relativ spontan gebildete, nicht einheitlich strukturierte, „bunt zusammengewürfelte[n] Militärformationen“758, die sich aus zurückkehrenden Soldaten und Matrosen sowie aus Angehörigen aller Bevölkerungsschichten und Berufsgruppen zusammensetzten und mehr oder weniger eng mit den früheren Schutzmannschaften zusammenarbeiteten. Die von den Arbeiter- und Soldatenrä- 755 Vgl. Schmidt, Schützen und Dienen, S. 64. 756 Leßmann-Faust, Die Preußische Schutzpolizei, S. 8. 757 Vgl. Leßmann-Faust, Die Preußische Schutzpolizei, S. 22ff.; Schmidt, Schützen und Dienen, S. 66; H. Schmidt, Sicherheit in stürmischen Zeiten – Velberter Polizeigeschichte von 1914-1933, Velbert 2009, S. 12ff.; Bessel, Policing, S. 189 f.; E. Radecke, Die Einwohnerwehren nach dem Ende des Ersten Weltkrieges, in: Archiv für Polizeigeschichte, 9. Jg. (1998), Nr. 2, S. 47ff.; P. Leßmann-Faust, Die Einwohnerwehren nach dem Ersten Weltkrieg, in: Archiv für Polizeigeschichte, 9. Jg. (1998), Nr. 3, S. 91ff. 758 Leßmann-Faust, Geschichte der Polizei, S. 19. IV. Die deutsche Polizei in der Zwischenkriegszeit 176 ten gebildeten Arbeiter- und Soldatenwehren wurden in der Regel von Gewerkschaftern oder Sozialdemokraten geleitet und hatten Anfang 1919 eine Gesamtstärke von etwa 100.000 bis 200.000 Mann, während ihre bürgerlichen Pendants – die in der Regel von aktiven oder reaktivierten Offizieren geleiteten, vom Heer und von lokalen Behörden und Unternehmern unterstützten, politisch dem rechten Spektrum zugehörigen Einwohnerund Bürgerwehren – bis Mitte 1919 sogar auf eine Gesamtstärke von ca. 300.000 Mann kamen.759 In den von extremer politischer Gewalt geprägten ersten drei Monaten des Jahres 1919 – d. h. zwischen den ‚Berliner Weihnachtskämpfen‘760 und dem ‚Berliner Blutmassaker‘761 – wurden die revolutionären Arbeiter- und Soldatenwehren allerdings nahezu vollständig aufgelöst bzw. ‚zerschlagen‘, wobei Peter Leßmann-Faust wegen der dabei angewandten Brutalität sogar von einer „Liquidierung der Wehren“762 spricht. Ursächlich hierfür war die im Zuge des so genannten ‚Ebert-Groener- Paktes‘763 bereits am 10. November 1918 vereinbarte Kooperation zwischen der sozialdemokratisch dominierten Regierung und der eher monarchistisch-konservativ orientierten Obersten Heeresleitung, die das Militär zur wichtigsten ordnungspolitischen Ordnungsmacht in der noch jungen Republik machte. Gegen die seit Anfang 1919 zur Niederschlagung von Aufständen und Unruhen wie dem ‚Spartakus-Aufstand‘764 eingesetzten, schwerbewaffneten und kampferfahrenen Militäreinheiten waren die verschiedenen ‚Wehren‘ der Arbeiter- und Soldatenräte chancenlos.765 Dies galt umso mehr, als die Truppen bei diesen gewaltsamen Auseinandersetzungen zunehmend von rechtsradikalen Freiwilligen-Formationen, Freikorps, Einwohnerwehren und Bauernwehren unterstützt wurden, die ins- 759 Vgl. Leßmann-Faust, Weimarer Republik, S. 32 f.; M. Geyer, Die Wehrmacht der Deutschen Republik ist die Reichswehr – Bemerkungen zur neueren Literatur, in: Militärgeschichtliche Mitteilungen, 14. Jg. (1973), Nr. 2, S. 168 f.; E. Kolb, Die Arbeiterräte in der deutschen Innenpolitik 1918/1919, Frankfurt a. M. u. a. 1978, S. 294ff. und S. 307ff. 760 Vgl. Ulrich, Die Revolution, S. 63ff.; Niedhart, Deutsche Geschichte, S. 33. 761 Vgl. Hürten, Bürgerkriege in der Republik, S. 85 f.; Mai, Die Weimarer Republik, S. 24. 762 Leßmann-Faust, Die Preußische Schutzpolizei, S. 24 f. 763 Vgl. Jesse, Systemwechsel in Deutschland, S. 37; Gessner, Die Weimarer Republik, S. 8. 764 Vgl. Broué, The German Revolution, S. 227ff. und S. 245ff.; Thoß, Demokratie ohne Demokraten, S. 24ff. 765 Vgl. Leßmann-Faust, Die Preußische Schutzpolizei, S. 37ff.; Schmidt, Schützen und Dienen, S. 66ff. 1. Zusammenbruch und Neuaufbau (1918-23) 177 gesamt auf eine Stärke von mehr als 400.000 Mann kamen.766 Gerade der von der sozialdemokratischen Regierung gebilligte Einsatz von Freikorps zur Aufrechterhaltung der öffentlichen Ordnung – und damit eindeutig in polizeilicher Funktion – sollte sich als besonders folgenreich für die weitere Entwicklung der Polizei in der Weimarer Republik erweisen, weil ihr äußerst gewaltsames Vorgehen gegen die Arbeiter- und Soldatenräte und ihre Sicherheitsorgane eine dezidiert polizeikritische Einstellung im linken politischen Lager beförderte, die in der Folgezeit dazu führte, dass Personen mit einer entsprechenden politischen Einstellung kaum für eine Tätigkeit in der Polizei zu gewinnen waren.767 In den Beiträgen in der ZDPol wurden die Arbeiter-, Soldaten-, Einwohner- und Bürgerwehren sowie ihre Rolle im Rahmen der in den ersten Monaten der Weimarer Republik stattgefundenen, gewaltsamen Unruhen und bewaffneten Aufstände nahezu vollständig ausgeblendet. Eine Ausnahme war der im Februar 1919 publizierte Beitrag des Oberregierungsrates Haaselau mit dem Titel „Die öffentliche Sicherheit“, der nicht nur die unbefriedigende allgemeine Sicherheitslage beklagte, sondern vor allem die Einrichtung von Arbeiter- und Soldatenwehren massiv kritisierte.768 Dabei lobte er zunächst die besondere Leistungsfähigkeit der Berliner Polizei in der Zeit vor und während des Ersten Weltkrieges, um dann auszuführen: „Die neue Regierung hat nun leider den Schwabenstreich begangen, sich dieses nützlichen Instruments zu berauben, indem sie die Schutzleute entwaffnete und dadurch zur Untätigkeit verdammte, während gleichzeitig die Herren Liebknecht und Eichhorn das Gesindel bewaffneten. Erst die sich daraus entwickelnden Zustände, die man wohl ohne viel Scharfsinn voraussehen konnte, haben die Regierung bestimmt, die Schutzmannschaft wieder in ihre Rechte einzusetzen. Aber leider folget nun sogleich – ein zweiter Streich. Es wird unter Androhung von drakonischen Strafen die Abgabe aller Waffen binnen 24 Stunden verlangt. Ergebnis: die anständigen Leute […] geben die Waf- 766 Vgl. J. Flemming, Die Bewaffnung des ‚Landvolks‘ – Ländliche Schutzwehren und agrarischer Konservativismus in der Anfangsphase der Weimarer Republik, in: Militärgeschichtliche Mitteilungen, 20. Jg. (1979), Nr. 2, S. 7ff.; E. Könnemann, Einwohnerwehren und Zeitfreiwilligenverbände, Berlin (Ost) 1971, S. 391 f.; Liang, Die Berliner Polizei, S. 48 f.; Buder, Die Reorganisation der preußischen Polizei, S. 28ff.; Leßmann-Faust, Gewalt und Gewaltmonopole, S. 243 f. 767 Vgl. Leßmann-Faust, Die Preußische Schutzpolizei, S. 43 f. 768 Vgl. Haaselau, (Vorname fehlt), Die öffentliche Sicherheit, in: ZDPol, 15. Jg. (1918/19), Nr. 23 (13.2.1919), S. 410 f. IV. Die deutsche Polizei in der Zwischenkriegszeit 178 fen ab; das Gesindel behält sie als Handwerkszeug ihres Berufs; die öffentliche Sicherheit verhüllt ihr Haupt.“769 Sehr deutlich wurde hier nicht nur die offensichtliche Machtlosigkeit der früheren Schutzmannschaft und die damit einhergehende Frustration der Beamten, sondern auch die radikale Ablehnung der Arbeiter- und Soldatenräte als Sicherheitsorgane, die der Autor in dieser kurzen Passage gleich zweimal als „Gesindel“ bezeichnet und denen er offensichtlich nicht zutraute, für Sicherheit und Ordnung zu sorgen. Das Hauptaugenmerk seiner Kritik galt allerdings zunächst der Regierung, die er für die Einrichtung der Soldaten- und Arbeiterwehren und damit auch für die katastrophale Sicherheitslage in Berlin zu Beginn des Jahres 1919 verantwortlich machte. Interessant war in diesem Zusammenhang aber die explizite Erwähnung des USPD- und späteren KPD-Mitglieds sowie kurzzeitigen Berliner Polizeipräsidenten Emil Eichhorn770 sowie des zum Zeitpunkt der Publikation bereits ermordeten KPD-Gründers Karl Liebknecht, die darauf hindeutete, dass er trotz seiner Kritik an der SPD-geführten Regierung wohl nicht primär die regierenden Sozialdemokraten, sondern die Kommunisten als die eigentliche Ursache für die unbefriedigende Sicherheitslage ansah. Wie die folgende Passage zeigte, war seine Kritik an der Regierung insgesamt durchaus sachlich, aber auch sehr deutlich und energisch formuliert. „Auch die Art und Weise, wie die Regierung die Ausschreitungen des Spartakusbundes bekämpft, stellen eine Gefährdung der öffentlichen Sicherheit dar. Sie schwankt dauernd zwischen Entschlossenheit und Schwäche. Nehmen die Plünderungen zu, so rafft sie sich zur entschlossenen Bekämpfung der Spartakusleute auf. Hat diese Bekämpfung Erfolg, so erfaßt sie die Angst, die siegreichen Kämpfer könnten zu einem Werkzeug der Reaktion werden, und es wird von einer völligen Unschädlichmachung der Störer der Ordnung Abstand genommen. […] Die Regierung möge bedenken, daß die Truppen und die freiwillige Bürgerwehr nicht lange gewillt sein werden, ihr Blut hinzugeben gegen Aufrührer, die man heute besiegt, aber entwaffnet entläßt, um ihnen morgen, mit neuen Waffen versehen, an anderer Stelle 769 Haaselau, Die öffentliche Sicherheit (13.2.1919), S. 410. 770 Vgl. Buder, Die Reorganisation der preußischen Polizei 1918-1923, S. 22; Leßmann-Faust, Die Preußische Schutzpolizei, S. 25 f. 1. Zusammenbruch und Neuaufbau (1918-23) 179 wieder zu begegnen und zu ihrer Bekämpfung von neuem ihr Leben aufs Spiel zu setzen.“771 Haaselaus Ausführungen bestätigten, dass die Polizei in diesen ersten Monaten der Republik offensichtlich keinen nennenswerte Beitrag zur Niederschlagung der Aufstände leistete, da nur die „Truppen und die freiwillige Bürgerwehr“, also das Militär und die rechten Freikorps, als Akteure erwähnt wurden. Zudem wurde deutlich, dass sich die Polizei – und vermutlich auch der Großteil der Bevölkerung – sehr genau des Dilemmas bewusst war, den der Einsatz des Militärs und insbesondere der Freikorps zur Bekämpfung der kommunistischen Aufstände für die SPD-geführte Regierung darstellte. Einerseits war sie in der Regierungsverantwortung und damit für die Aufrechterhaltung der öffentlichen Ordnung zuständig, andererseits waren ihr die ‚Aufständischen‘ ideologisch deutlich näher als die sie im Auftrag der Regierung bekämpfenden, rechten Freikorps und konservativ-monarchistischen Militäreinheiten. Haaselau argumentierte dabei zumindest vordergründig aus einer politisch neutralen, rein polizeifachlichen Position, in der die vom linken politischen Lager ausgehenden Unruhen das zu lösende Problem und das Militär sowie die Freikorps die Problemlösung darstellten. Seine Wortwahl, bei der die linken ‚Aufständischen‘ als „Gesindel“, „Plünderer“, „Störer“ und „Aufrührer“, die rechten Freikorps hingegen als „freiwillige Bürgerwehr“ und „siegreiche Kämpfer“ bezeichnet wurden, deutete allerdings auf eine rechte politische Gesinnung des Autors hin. Dazu passte auch die von ihm hier vorgeschlagene Strategie der „entschlossenen Bekämpfung der Spartakusleute“ bis zu ihrer „völligen Unschädlichmachung“. Die Rolle, die die Polizei nach Ansicht von Haaselau in diesem Zusammenhang spielen sollte, beschrieb er weiter unten. „Will die Regierung ernstlich Leben und Eigentum der Bürger schützen, die Sicherheit der öffentlichen Straße wieder herstellen, so setze sie die Schutzmannschaft voll in ihre alten Rechte ein und gebe ihr einen energischen und weitblickenden Führer, der im Polizeidienst erfahren ist […], und verhänge das Standrecht, wonach jeder, der beim Plündern oder mit Waffen in der Hand angetroffen wird, seiner sofortigen Aburteilung entgegensieht.“772 771 Haaselau, Die öffentliche Sicherheit (13.2.1919), S. 411. 772 Haaselau, Die öffentliche Sicherheit (13.2.1919), S. 411. IV. Die deutsche Polizei in der Zwischenkriegszeit 180 Trotz seiner deutlichen Kritik an der politischen Führung und an der allgemeinen Sicherheitslage stellte er nicht etwa die Legitimität der Regierung in Frage, sondern forderte vielmehr die Wiedereinsetzung der früheren Schutzmannschaft, damit die Polizei wieder der zentrale Träger des staatlichen Gewaltmonopols im Inneren würde. Insofern hatte selbst Haaselau, der offensichtlich eine sehr konservative, rechte politische Gesinnung aufwies, die Funktion der Polizei als Instrument staatlicher Herrschaft so weit verinnerlicht, dass er anscheinend keine Bedenken hatte, der neuen, von linken politischen Kräften geleiteten Regierung dieses Herrschaftsmittel zur Verfügung zu stellen, damit sie die öffentliche Sicherheit und Ordnung wiederherstellen konnte. Gleichwohl verdeutlichte dieser Beitrag insgesamt, vor allem aber die im letzten Satz der oben zitierten Passage geforderte, standrechtliche „sofortige Aburteilung“ von Aufständischen durch die Polizei, dass die in den oben behandelten Beiträgen von Heinrich Eiben und Wollenberg festgestellten Ansätze einer positiven Haltung gegenüber demokratischen und sogar sozialistischen Ideen in der deutschen Polizei keinesfalls verallgemeinert werden durften. Das sich in Haaselaus Beitrag widerspiegelnde Selbstbild der Polizei ließ sich nur schwerlich in Einklang bringen mit Wollenbergs Vorstellung der Polizei als „Vollstrecker des Gemeinschaftswillens“773 oder Heinrich Eibens Forderung, dass „[d]es Polizisten Herz […] jedem gehören [soll], ohne Rücksicht auf den Rang, Stand, Vermögen und politische Gesinnung“774. Noch sehr viel deutlicher wurde dieser Kontrast, wenn man einen weiteren von Heinrich Eiben in der ZDPol publizierten Beitrag berücksichtigt, der wegen seiner Länge ab dem 10. April 1919 in mehreren Teilen unter dem Titel „Polizei der Demokratie“ erschien. Darin stellte der Autor bereits zu Beginn des ersten Teils seines Aufsatzes unmissverständlich fest: „Mit aller Bestimmtheit dürfen wir versichern, daß der Geist der nun dem ganzen Volke gewordenen Freiheit sehr bald bei uns seine kräftigsten Wurzeln findet […]. Immer dem Pulsschlage des Lebens der herrschenden Volksklassen folgend, glauben wir versichern zu dürfen, daß wir fortan weniger eine gefürchtete Macht als ein machtvoller Förderer des Volkswillens sein werden und wir, ebenso wie früher dem absoluten Regiment, nunmehr die zuverlässigste Stütze der gegenwärti- 773 Wollenberg, Die Beziehungen zwischen Politik und Polizei (22.5.1919), S. 79. 774 Eiben, Die Polizei-Exekutivbeamten der neuen Zeit (19.12.1918), S. 329. 1. Zusammenbruch und Neuaufbau (1918-23) 181 gen Regierung sein werden, indem wir auswachsen zu einer Polizei der Demokratie.“775 Der Autor ließ hier also keine Zweifel daran aufkommen, dass er die Polizei nicht nur in einem abstrakten Sinn als Herrschaftsinstrument des Staates betrachtete, sondern ganz konkret damit die ‚gegenwärtige‘, SPD-geführte Regierung meinte. Zugleich verdeutlichte seine Wortwahl, dass er von den Vorzügen der neuen, demokratischen Staatsform auch für die Polizei überzeugt war, da diese gewährleiste, dass die Polizei durch ihre Unterstützung der gegenwärtigen Regierung zugleich zum „machtvolle[n] Förderer des Volkswillens“ würde. Auffällig ist, dass Heinrich Eibens Beitrag – im Gegensatz zum zuvor behandelten Aufsatz von Haaselau – auf Kritik an der Regierung uns insbesondere an der von ihr mitverantworteten, äußerst unbefriedigenden Sicherheitslage zu Beginn des Jahres 1919 verzichtete, obwohl dies aus polizeilicher Sicht durchaus angebracht gewesen wäre. Insofern scheinen durchaus Zweifel angebracht, ob Heinrich Eibens Einschätzungen von der Mehrzahl der Polizeibeamten geteilt wurden bzw. ein wahrheitsgetreues, repräsentatives Bild der damaligen Polizei zeichneten. Wie der zwei Wochen später erschienene zweite Teil seines Beitrags verdeutlichte, war sich der Autor dieser Problematik wohl durchaus bewusst. Darin führte er aus, dass die von ihm angestrebte Einrichtung einer „Polizei der Demokratie“ eine gewaltige Herausforderung darstellte, die eine grundlegend neue strategische Ausrichtung und insbesondere eine geänderte Personalpolitik erforderte: „Eine den berechtigten Ansprüchen gewachsene Polizei ist nur lebensfähig, wenn sie sich aus Kräften zusammensetzt, die ihre Wurzeln in den verschiedensten Volksschichten und durch Herkunft, Bildung und Umgang Gelegenheit haben, alle Anschauungen auf sich oder besser auf uns wirken zu lassen.“776 Sein Plädoyer für eine Personalpolitik, die darauf abzielten sollte, Polizeibeamte aus allen Bevölkerungsschichten – und damit eben auch aus dem Arbeitermilieu – zu rekrutieren, dürfte seine Erkenntnis widerspiegeln, dass ein großer Teil der Polizeibeamtenschaft eine konservativ-monarchistische Gesinnung pflegte und sich daher nur sehr eingeschränkt für die ihr von ihm zugedachte Rolle als „zuverlässigste Stütze“777 der SPD-geführten 775 Eiben, Die Polizei der Demokratie (10.4.1919), S. 10. 776 Eiben, Die Polizei der Demokratie (24.4.1919), S. 33. 777 Eiben, Die Polizei der Demokratie (10.4.1919), S. 10. IV. Die deutsche Polizei in der Zwischenkriegszeit 182 Regierung würde begeistern lassen, so dass nur eine umfassende personelle Erneuerung die Grundlage für seine ‚Polizei der Demokratie‘ schaffen könne. Zugleich deuteten Heinrich Eibens unmissverständliche Forderungen nach einer Aussöhnung der Polizei mit der Arbeiterschaft und einer engen und vertrauensvollen Beziehung zu den unteren Bevölkerungsschichten auch auf einen gewissen Mangel an Rückhalt und Akzeptanz der Polizei in diesen Gesellschaftsschichten hin, den es zu überwinden galt. Dies verdeutlichte auch die folgende Passage aus seinem bereits im Dezember 1918 erschienenen Beitrag: „Die große Mehrzahl der [Polizei-] Beamten sind Söhne der unteren Klassen und leben mit ihren Familien in intimer Gemeinschaft mit ihnen. Sämtlich kommen wir aber mehr mit den unteren, als mit den oberen Schichten in Berührung, und haben auch wir, wie jeder andere, das Bedürfnis, mit den Menschen unserer Umgebung und des täglichen Verkehrs in Ruhe und Frieden zu leben. Zweck- und nutzloser Kampf liegt uns fern.“778 Heinrich Eibens eindeutiges Bekenntnis zur demokratischen Verfassung der Weimarer Republik und zur demokratisch gewählten Regierung sowie sein Plädoyer für eine bürgerorientierte ‚Polizei der Demokratie‘, die auch die Interessen der unteren Bevölkerungsschichten vertrat, stand in starkem Kontrast zu Haaselaus Charakterisierung der dem Arbeitermilieu entstammenden Demonstranten und ‚Aufständischen‘ als „Gesindel“ und „Störer“ und damit als Feindbild der Polizei. Dieser Kontrast veranschaulicht einerseits den Kerngedanken des konflikttheoretischen Ansatzes der Polizeisoziologie, nämlich die Gefahr, dass die Polizei als Mittel der herrschenden Klassen zur Erhaltung ihrer Macht und zur Unterdrückung der unteren Gesellschaftsschichten missbraucht wird779, und verdeutlichte andererseits, dass es in der deutschen Polizei in den ersten Monaten nach der Novemberrevolution sehr unterschiedliche und durchaus widersprüchliche Auffassungen gab, wie sich die Polizei unter den neuen politischen und gesellschaftlichen Rahmenbedingungen entwickeln sollte. Auch wenn Haaselaus Aussagen vor dem Hintergrund der katastrophalen Sicherheitslage in Berlin zu Beginn des Jahres 1919 zu sehen sind, die eindeutig durch das linksextreme politische Lager verursacht wurde, so deuteten sie aber zweifelsohne auf das Vorhandensein einer nicht unerheblichen monarchistischreaktionären ‚Strömung‘ innerhalb der Polizei hin, die der neuen Staats- 778 Eiben, Die Polizei-Exekutivbeamten der neuen Zeit (19.12.1918), S. 329 f. 779 Vgl. Reiner, The Politics of the Police, S. 39ff. 1. Zusammenbruch und Neuaufbau (1918-23) 183 ordnung kritisch bis ablehnend gegenüberstand und vor allem im Polizeioffizierskorps780 dominant war. Gleichwohl gab es auch eine erhebliche Anzahl an Polizeibeamten, insbesondere unter den Wachtmeistern, aber vereinzelt auch unter den Offizieren, die eher mit den Aussagen Heinrich Eibens sympathisierten und eine demokratisch-republikanische ‚Strömung‘ der Polizei repräsentierten.781 Eine seriöse Quantifizierung dieser beiden ‚Strömungen‘ ist auf der Grundlage der hier ausgewerteten Quellen nicht möglich. Tendenziell ist allerdings davon auszugehen, dass die rechtsradikale, reaktionäre ‚Strömung‘ in den folgenden Monaten und Jahren an Gewicht gewann, weil viele Angehörige der rechtsradikalen Freikorps in die neu gebildeten Polizeieinheiten eintraten.782 Insofern ist für die Anfangsjahre der Weimarer Republik von einen relativ hohen Anteil an Polizeibeamten mit einer dezidiert antirepublikanischen Gesinnung auszugehen. Gleichwohl zeigen die oben erwähnten, in der ZDPol erschienenen Beiträge von Heinrich Eiben und Wollenberg, dass auch eine mehr oder weniger große Anzahl von Polizeibeamten mit einer ebenso dezidierten republikanischen Gesinnung existierte und sich durchaus publikumswirksam zu Wort meldete. Auch wenn man die Bedeutung dieser republikanischen ‚Strömung‘ in der Polizei nicht überbewerten darf und die Revolution an der traditionell konservativ-deutschnationalen Gesinnung vieler, vermutlich sogar der meisten Polizeibeamten kaum etwas geändert haben dürfte783, so sollte man sie auch nicht unterschätzen. Zumindest zeigten die folgenden Monate und Jahre, dass die Polizei offensichtlich kein Problem damit hatte, in einem demokratischen Staat sozialistischer Prägung SPD-geführten Regierungen zu dienen, den Weisungen von sozialdemokratischen Innenministern zu folgen und die damit eingehergehende, einschneidenden „Änderung der Arbeitsgrundlage“784 zu akzeptieren. 780 Vgl. Leßmann-Faust, Die Preußische Schutzpolizei, S. 153ff. 781 Vgl. Knatz, Polizei in der Weimarer Republik, S. 42 f.; Leßmann-Faust, Die Preußische Schutzpolizei, S. 142ff. und S. 183ff. 782 Vgl. Schmidt, Schützen und Dienen, S. 68. 783 Vgl. Schmidt, Schützen und Dienen, S. 66. 784 Leßmann-Faust, Weimarer Republik, S. 38. IV. Die deutsche Polizei in der Zwischenkriegszeit 184 Erste polizeiliche Strukturen War die innere Sicherheit in den ersten Monaten der Weimarer Republik noch durch ein unübersichtliches und offensichtlich provisorisches Neben- und Gegeneinander von diversen Sicherheitsorganen geprägt, so begannen nach den Wahlen zur verfassungsgebenden Landesversammlung in Preußen am 25. März 1919 auf Anregung des sozialdemokratischen Reichswehrministers Gustav Noske die konkreten Planungen zur Errichtung einer ‚neuen‘ Polizei.785 Auch wenn die Zuständigkeit für die Planung zunächst im preußischen Innenministerium angesiedelt war, so war von Anfang an eine Übertragung der Ergebnisse auf das gesamte Reich geplant. Das Ergebnis dieser Planungen waren die vom Preußischen Innenministerium am 31. Mai 1919 veröffentlichten Organisationsrichtlinien für die Berliner Polizei.786 Sie sahen vor, die Restbestände der ehemaligen Kaiserlichen Schutzmannschaften in eine Ordnungspolizei zu überführen, die unter kommunaler bzw. städtischer Aufsicht eher wohlfahrtspolizeiliche Aufgaben übernehmen sollte. Daneben sollte eine der Regierung unterstellte und damit der kommunalen Aufsicht entzogene, militärisch strukturierte, mit schwerer Bewaffnung und militärerfahrenem Personal ausgestattete Sicherheitspolizei entstehen, die für die Sicherung der staatlichen Ordnung sowie für die Abwehr von gewaltsamen Angriffen gegen Leben und Eigentum zuständig sein sollte. Die Sicherheitspolizei sollte nach militärischem Vorbild grün uniformiert sein, während die blauen Uniformen der Ordnungspolizei ihren weitgehend zivilen Charakter symbolisieren sollten. Die Kriminalpolizei sollte weitgehend unverändert weitergeführt werden.787 Bei der Polizei – d. h. bei den noch im Dienst befindlichen Beamten der ehemaligen Kaiserlichen Schutzmannschaft – stieß diese Reform, die auch über Berlin hinaus auf alle anderen preußischen Provinzen übertragen b) 785 Vgl. Leßmann-Faust, Geschichte der Polizei, S. 20. 786 Einen Abdruck des entsprechenden Erlasses findet man z. B. bei E. Klingelhöller, Der Verband Preußischer Polizeibeamten in seinem Werden und Wirken, Berlin 1926, S. 63ff. 787 Vgl. Buder, Die Reorganisation der preußischen Polizei, S. 46ff.; Schmidt, Schützen und Dienen, S. 71ff.; Leßmann-Faust, Die Preußische Schutzpolizei, S. 47ff.; Schmidt, Sicherheit in stürmischen Zeiten, S 24ff.; P. Leßmann, Mit ‚Manneszucht‘ gegen ‚irregeleitete Volksgenossen‘ – Bildung und Ausbildung der preußischen Schutzpolizei in der Weimarer Republik, in: H. Reinke [Hrsg.], »… nur für die Sicherheit da …« – Zur Geschichte der Polizei im 19. und 20. Jahrhundert, Frankfurt a. M. u. a. 1993, S. 74ff. 1. Zusammenbruch und Neuaufbau (1918-23) 185 werden sollte, von Anfang an auf massive Kritik.788 Ein früher Beitrag in der ZDPol, der sich ausführlich mit dieser Thematik beschäftigte und die kritische Grundhaltung der Polizei deutlich zum Ausdruck brachte, war der vom Berliner Kriminal-Oberwachtmeister Füth am 14. August 1919 publizierte Aufsatz mit dem Titel „Zur Reform der Polizei“. Dieser beschäftigte sich zunächst mit den Vor- und Nachteilen sowie der politischen Umsetzbarkeit einer Unterstellung der Polizei unter kommunale bzw. zentralstaatliche Aufsicht, bevor er dann seinen zentralen Kritikpunkt anbrachte, nämlich die Trennung in eine zivile Ordnungspolizei und eine militärisch geprägte Sicherheitspolizei. Dabei hatte er angesichts der äußerst angespannten Sicherheitslage in Berlin und anderen Großstädten zwar Verständnis für die Einrichtung der von ihm als „Polizeitruppe“ bezeichneten Sicherheitspolizei, allerdings nur temporär und auf urbane Räume beschränkt. „So wertvoll auch die neue Organisation heute sein mag, so kann es sich doch nur um eine Einrichtung handeln, die beim Eintritt besserer Verhältnisse wieder in Fortfall kommen muss. Schon die Kostenfrage spielt hier eine erhebliche Rolle. Die Polizeitruppe kann niemals die ordentliche Polizei ersetzen.“789 Wie seine folgenden Ausführungen verdeutlichten, sah er aber nicht die hohen Kosten als zentrales Problem, sondern vielmehr die unzureichende Bürgerorientierung der Sicherheitspolizei. „Ein Polizeibeamter soll bekanntlich ein Helfer, Freund und Berater der Staatsinsassen sein. Er soll das Vertrauen der Bevölkerung genießen und der Mann sein, an dem man sich in der Not wendet. […] Er, der dem Volke dienen soll, muß mit der Bevölkerung leben und mit ihr fühlen. Wenn er den richtigen Ton finden und sich das Vertrauen aller erhalten will, muß er alles Schroffe von sich abstreifen und in beinahe väterlicher Weise auf Leiden und Nöte seiner Volksgenossen einzugehen verstehen. Dies alles kann zwar auch ein Angestellter der Polizeitruppe; er kann es aber niemals in dem Maße wie sein Kollege von der richtigen Polizei.“790 788 Vgl. Leßmann-Faust, Die Preußische Schutzpolizei, S. 54 f. 789 Füth, (Vorname fehlt), Zur Reform der Polizei, in: ZDPol, 16. Jg. (1919/20), Nr. 10 (14.8.1919), S. 235. 790 Füth, Zur Reform der Polizei (14.8.1919), S. 235. IV. Die deutsche Polizei in der Zwischenkriegszeit 186 Dieses sehr deutliche Bekenntnis für eine bürgernahe, dem gesamten Volk und damit auch den unteren Gesellschaftsschichten dienende Polizei stand in Einklang mit den bereits oben analysierten, in der ZDPol erschienenen Beiträgen von Heinrich Eiben und Wollenberg und muss somit als weiteres Indiz dafür betrachtet werden, dass solche Einstellungen in dieser frühen Phase der Weimarer Republik unter den Polizeibeamten durchaus auf Akzeptanz stießen. Allerdings muss hierzu einschränkend angemerkt werden, dass Füth als ehemaliger Angehöriger der Kaiserlichen Schutzmannschaft bei seiner Kritik an der neuen, die ehemaligen Schutzmänner in eine wohlfahrtspolizeiliche Funktion verdrängende Sicherheitspolizei vermutlich alles andere als unparteiisch war. Auch dürfte seine starke Betonung der Notwendigkeit einer umfassenden Bürgerorientierung der Polizei sicherlich nicht nur Ausdruck von tiefsitzenden Überzeugungen, sondern auch eine Reaktion auf die akute berufliche Bedrohung der ehemaligen Schutzmänner durch die neue, militärisch geprägte Sicherheitspolizei sein, was sich nicht zuletzt in seiner durchaus etwas überspitzt formulierten Kritik zeigte. So stellte er in Bezug auf Angehörige der Sicherheitspolizei fest: „Er gehört einer militärischen Organisation an, wohnt in einer Kaserne und kommt in Ausübung seines Dienstes mit dem kleinen Manne niemals in ein so vertrautes Verhältnis wie der Beamte der alten Polizei. Seine Tätigkeit und diejenige seiner Truppe sind auf etwas ganz anderes eingestellt, nämlich ausschließlich auf Anwendung von Zwang mit allen Mitteln. Die Bevölkerung muß also in der Polizeitruppe nicht ihren gewohnten Helfer, Retter, Berater, wohl aber ganz instinktiv ihren natürlichen Gegner erblicken […]. Die Volksmasse hat vom Kriege und von allen kriegerischen Kampfmitteln übergenug, und auch aus diesem Grunde wird eine militärische Sicherheitspolizei niemals volkstümlich werden.“791 Auch wenn es dieser Analyse offensichtlich etwas an Unvoreingenommenheit mangelte und vor allem die Einschätzung der Sicherheitspolizei als „natürliche[r] Gegner“ der Bevölkerung ziemlich abwegig war, so darf dabei aber nicht übersehen werden, dass der dieser Argumentation zu Grunde liegende Kerngedanke – nämlich die aufgrund des militärischen Charakters der Sicherheitspolizei zu erwartenden Akzeptanzprobleme in der Bevölkerung und insbesondere beim „kleinen Manne“ – zweifelsohne plausibel war. Gleichwohl waren militärische Denk- und Verhaltensmuster 791 Füth, Zur Reform der Polizei (14.8.1919), S. 235. 1. Zusammenbruch und Neuaufbau (1918-23) 187 sowie Symbole seit jeher – und bis zum heutigen Tage – eine zentraler Bestandteil der polizeilichen Organisationskultur, die das Alltagshandeln der Polizeibeamten auf einer unbewussten, emotionalen Ebene maßgeblich prägten, so dass eine so deutliche Kritik daran von vielen Polizeibeamten als Angriff auf ihre berufliche Identität empfunden worden sein müsste.792 Dies galt erst Recht für die Polizei des Kaiserreichs, die eine besonders stark ausgeprägte militärische Orientierung aufwies.793 Insofern dürfte die zum Großteil aus ehemaligen Kaiserlichen Polizeibeamten bestehende Leserschaft dieses Artikels die Argumentation von Füth keinesfalls uneingeschränkt begrüßt, sondern durchaus mit ambivalenten Gefühlen zur Kenntnis genommen haben. Nur einen Monat später erschienen jedoch zwei weitere Artikel in der ZDPol, die diese Thematik wieder aufgriffen und dabei Füths Argumentation weiterentwickelten. Besonders interessant war dabei sicherlich der am 11. September 1919 publizierte Beitrag von Kurt Wolzendorf mit dem Titel „Die polizeiliche Bedeutung der Neuordnung der Berliner Exekutive“, da dieser als Professor für Öffentliches Recht an der Universität Halle vermutlich eine objektivere Analyse der Bedeutung des militärischen Charakters der Sicherheitspolizei liefern konnte als unmittelbar selbst betroffene Polizeibeamte. Dabei machten schon die ersten Sätze dieses Beitrags deutlich, dass das Spannungsfeld zwischen Militarisierung und Demokratisierung die Polizei schon seit längerer Zeit beschäftigte. „Den Lesern dieser Zeitschrift braucht nicht erst des längeren auseinandergesetzt zu werden, was das Hauptproblem in allen Fragen der Organisation der [Polizei-] Exekutive ist. […] Es ist die Notwendigkeit der Befreiung von dem militärischen Geist, der die Aufmerksamkeit des Exekutivbeamten zu sehr festhält in der Beachtung der Befehle und Rüffel von oben und sie daher nicht genügend freiläßt für die eigentliche Berufsaufgabe gegenüber den Volksgenossen, daher umgekehrt diesen die Erkenntnis erschwert, die ja in keinem Lande so fehlte wie in Deutschland, daß der Polizist nicht ein Mann ist, der immer nur befehlend etwas vom Bürger will, sondern der allein für den Bürger tätig ist, als sein ‚Schutzmann‘.“794 792 Vgl. Vera, Organisation und Personalmanagement, S. 61ff. und insb. S. 71ff.; Clark, The Importance of a New Philosophy, S. 642ff. 793 Vgl. Funk, Die Entstehung der Exekutivpolizei, S. 22 f. 794 K. Wolzendorf, Die polizeiliche Bedeutung der Neuordnung der Berliner Exekutive, in: ZDPol, 16. Jg. (1919/20), Nr. 12 (11.9.1919), S. 289. . IV. Die deutsche Polizei in der Zwischenkriegszeit 188 Daran, dass die Notwendigkeit einer Verbürgerlichung der Polizei mittlerweile von ihr erkannt und akzeptiert worden ist, schien Kurt Wolzendorf angesichts seiner zahlreichen, sehr deutlich formulierten Feststellungen in diesem Beitrag keinerlei Zweifel zu haben. Die starke militärische Orientierung der Polizei war seiner Einschätzung nach nicht nur ein Problem, sondern „das Hauptproblem in allen Fragen der Organisation“ und ein Grund dafür, dass die Polizei ihre „eigentliche Berufsaufgabe“, nämlich dem Bürger zu dienen, vernachlässige. Dementsprechend kritisch stand er der Einrichtung einer militärisch geprägten Sicherheitspolizei gegenüber. Gleichwohl fiel seine Analyse dieser Thematik wesentlich ausgewogener und differenzierter aus als Füths oben erörterte Kritik an der Sicherheitspolizei. So wies er sehr deutlich darauf hin, dass die Polizei gerade vor dem Hintergrund der allgegenwärtigen politischen Gewalt in Deutschland keinesfalls auf ein gewisses Maß an militärischer Kampfkraft verzichten konnte, wenn sie ihre Aufgaben in der Gesellschaft erfolgreich bewältigen wollte. „Wo, wie zur Zeit bei uns, die Friedensbrecher militärisch ausgestattet und organisiert sind, kann die staatliche Ordnung ihnen nur mit gleichartigen Mitteln entgegentreten. Aber hier zeigt sich nun schon die Schwierigkeit. Es bedarf einer Truppe, die vollständig militärisch ausgestattet und ausgebildet ist. Aber die Aufgabe dieser Truppe ist doch immer nur polizeilich.“795 Der letzte Satz deutet schon an, warum seiner Meinung nach die Einrichtung einer militärisch geprägten Sicherheitspolizei nicht zweckmäßig war. Es war nicht etwa ihr militärischer Charakter, sondern vielmehr die Tatsache, dass sie die bisherige Schutzmannschaft in den wohlfahrtspolizeilichen Bereich verdrängen und damit die Zuständigkeit für alle sicherheitspolizeilichen Aufgabenfelder – z. B. für den regulären Streifendienst – erhalten sollte. Für diese Aufgaben sei eine schwerbewaffnete, militärisch ausgebildete Sicherheitspolizei aber gänzlich ungeeignet. Zudem sei dies unvereinbar mit der von ihm als unverzichtbar und allgemein akzeptiert angesehenen Notwendigkeit einer Verbürgerlichung der Polizei. In diesem Zusammenhang verwies er unter anderem auf die Organisation der Polizei in anderen Ländern und insbesondere in den Metropolen Paris, New York und London, die trotz ihres eindeutig zivilen Charakters bei besonderen Gefährdungslagen mit hohem Gewaltpotenzial durchaus eine hohe militärische Schlagkraft aufweisen würden. Insofern plädierte er durchaus für die 795 Wolzendorf, Die polizeiliche Bedeutung der Neuordnung (11.9.1919), S. 290. 1. Zusammenbruch und Neuaufbau (1918-23) 189 Einrichtung einer militärisch geprägten Polizeitruppe in Berlin, die bei solchen besonderen Gefährdungslagen zum Einsatz kommen sollte, allerdings merkte er einschränkend an: „Die militärisch ausgestattete und ausgebildete Polizeitruppe kann immer nur eine Reserve, eine Ergänzung der Schutzmannschaft als der ordentlichen Polizeimacht […] sein. Sie setzt eine gute und zahlenmä- ßig genügende Schutzmannschaft voraus. Denn sie kann niemals deren Aufgaben übernehmen, so wenig jene ihre erfüllen kann. Beides setzt vollständig verschiedene Ausbildung, auch Berufsgewohnheiten und daher Berufspsychologie voraus.“796 Dementsprechend fasste er am Ende seines Betrags noch einmal das Ergebnis seiner kritischen Auseinandersetzung mit der gerade stattfindenden Reform der Berliner Polizei wie folgt zusammen: „Für beides ist Raum, und beides ist notwendig. Aber jedes an seinem Platze: die Schutzmannschaft als ordentliche Polizeiexekutive, für den regelmäßigen Straßendienst, die militärische Truppe als außerordentliche Polizeimacht zur Ergänzung jener, wenn erhöhte Gefährdung der von beiden zu verteidigenden öffentlichen Sicherheit und Ordnung es nötig macht.“797 Zu einem recht ähnlichen Ergebnis kam der im gleichen Heft der ZDPol erschienene Beitrag mit dem Titel „Neuorganisation der staatlichen Polizei“, den der bereits oben erwähnte Breslauer Polizeiinspektor Heinrich Eiben in seiner Funktion als stellvertretender Vorsitzender der Vereinigung der staatlichen höheren Polizei-Exekutivbeamten Preußens – und damit sicherlich weniger objektiv bzw. stärker interessengeleitet als der Universitätsprofessor Kurt Wolzendorf – publizierte. Dabei thematisierte er zunächst die grundsätzlichen Ursachen für die Schwierigkeiten der deutschen Polizei, den gewaltigen Herausforderungen in diesen ersten Nachkriegsjahren angemessen zu begegnen. „Klar vor aller Augen liegt die gegenwärtige Unzulänglichkeit der Exekutivpolizei. Sie wird begründet durch die fast vollständige Auflösung der alten Staats- und Rechtsordnung, den Zerfall unseres Heeres, die äußerst schwierigen Ernährungs- und Erwerbsverhältnisse und die 796 Wolzendorf, Die polizeiliche Bedeutung der Neuordnung (11.9.1919), S. 290. 797 Wolzendorf, Die polizeiliche Bedeutung der Neuordnung (11.9.1919), S. 291. IV. Die deutsche Polizei in der Zwischenkriegszeit 190 nach Zahl und Kraft ganz unzureichende Polizei-Exekutivmannschaft.“798 Im Anschluss daran ging er dann aber äußerst kritisch auf die laufende Reorganisation der Polizei ein, die seiner Ansicht nach nicht nur nicht im Geringsten geeignet war, diese Schwierigkeiten zu überwinden, sondern vermutlich sogar zu einer weiteren Verschlechterung der allgemeinen Sicherheitslage beitragen würde. „Die Durchführung der Absicht der Staatsregierung wird die so häufig beklagten Mißstände nur erhöhen. […] Auf Augenblickserscheinungen und -zuständen – und mit solchen haben wir es doch zu tun – eine Umformung eines der wichtigsten Glieder der Staatsmaschine vorzunehmen, ist doch recht bedenklich. […] Für die Gegenwart genügt es, wenn außer dem nach dem Friedensvertrage zulässigen Heer vorübergehend noch eine Polizeitruppe mit allen militärischen Macht- und Kampfmitteln unterhalten wird, die allmählich infolge des durch Überalterung und vorzeitige Abnutzung in Aussicht stehenden starken Abganges in die ordentliche Staatspolizei aufgehen kann. Sie muß aber von vornherein von erfahrenden Polizei-Exekutivbeamten mit angeleitet und berufsmäßig geschult werden. […] Mehr als Maschinengewehre und Handgranaten brauchen wir heute Kräfte, die nicht nur kurzentschlossen, tatkräftig zugreifen, sondern auch der Psyche des Volkes und der Psychologie der Gegenwart Rechnung zu tragen wissen.“799 Auch wenn sich die Argumentationen und die Empfehlungen bei Heinrich Eiben und Kurt Wolzendorf im Detail etwas unterschieden, so waren sie sich einig in der Ablehnung der Bildung einer schwerbewaffneten Sicherheitspolizei mit eindeutig militärischem Charakter, die die bisherigen Schutzmänner verdrängen sollte, und in ihrem Plädoyer für eine zivil geprägte, bürgernahe Polizei, die nur punktuell von einer militärisch geprägten Polizeitruppe unterstützt werden sollte. Hervorzuheben ist dabei insbesondere die doch mit bemerkenswerter Häufigkeit und Deutlichkeit im ersten Jahr der Weimarer Republik in der ZDPol geäußerte Ansicht, dass nur eine zivil orientierte, demokratischen Werten verpflichtete, allen Bevölkerungsschichten gleichermaßen dienende Polizei in der Lage sei, unter den damaligen Rahmenbedingungen die öffentliche Ordnung und 798 H. Eiben, Neuorganisation der staatlichen Polizei – Ein Wort zur Aufklärung von der Vereinigung der staatlichen höheren Polizei-Exekutivbeamten Preußens (e.V.), Sitz Hannover, in: ZDPol, 16. Jg. (1919/20), Nr. 12 (11.9.1919), S. 281. 799 H. Eiben, Neuorganisation der staatlichen Polizei (11.9.1919), S. 282 f. 1. Zusammenbruch und Neuaufbau (1918-23) 191 Sicherheit aufrecht zu erhalten. Allerdings dürfte dies zu einem gewissen Anteil auch auf die Tatsache zurückzuführen gewesen sein, dass die Autoren in der ZDPol meistens Angehörige der ehemaligen Kaiserlichen Schutzmannschaft und jetzigen Ordnungspolizei waren, die sich ab 1919 mit einer akuten Bedrohung ihres beruflichen Status und Prestiges durch die neue Sicherheitspolizei konfrontiert sahen.800 Diese Benachteiligung sprach Heinrich Eiben etwa ein Jahr später in einem weiteren Beitrag in aller Deutlichkeit an. „Die gegenwärtig ganz besonders in die Erscheinung tretenden und in noch weit größerem Maße die verhüllten Hemmungen, Reibungen und Widerstände sind begründet durch die vielfachen Vorteile und Vorzüge, die der Sicherheitspolizei (SP) gegenüber der Ordnungspolizei (OP) eingeräumt worden sind. Dies ist ganz besonders bei der Einordnung in die Gruppen der Besoldungsordnung zu erkennen, ergibt sich aber auch sehr klar aus der ganzen Einrichtung und Behandlung der SP. Ihre Angehörigen kommen in bedeutend jüngeren Jahren zu einem erheblich höheren Einkommen und sehr viel leichter und schneller zu höheren Dienstgraden als die Beamten der OP. Zu dem bitteren Gefühl über die schlechtere und wirtschaftliche Stellung gesellt sich bei gemeinsamer Arbeit sehr leicht und nicht unberechtigt der Unmut über die untergeordnete Stellung, die der Beamte der OP trotz größerer Fachkenntnisse gegenüber dem jüngeren Kameraden der SP einnimmt.“801 Die früheren Angehörigen der Kaiserlichen Schutzmannschaft und jetzigen Ordnungspolizisten wurden nicht nur schlechter bezahlt als die neuen Sicherheitspolizisten, sondern diesen auch im Arbeitsalltag hierarchisch untergeordnet, obwohl sie nach Einschätzung des Autors fachlich besser qualifiziert waren. Insofern erscheint es plausibel, dass auch Neid eine nicht unerhebliche Ursache für die in Publikationen in der ZDPol geäu- ßerte Kritik an der militärisch geprägten Sicherheitspolizei war. Allerdings erscheint es sehr wahrscheinlich, dass diese Kritik auch auf eine tatsächlich vorhandene und in der Literatur bisher ignorierte demokratische, bürgerorientierte Gesinnung bei einem nicht unerheblichen Teil der noch aus dem Kaiserreich stammenden Polizei hindeutete. Die teilweise sehr deutli- 800 Vgl. Leßmann-Faust, Die preußische Schutzpolizei, S. 54 f. 801 H. Eiben, Die Einheitspolizei – Ein Vorschlag zu ihrer Bildung, in: Führer der Polizeiexekutive, Beilage zu der ZDPol, 17. Jg. (1920/21), Nr. 9 (22.7.1920), S. 205. IV. Die deutsche Polizei in der Zwischenkriegszeit 192 che, selbstkritische Auseinandersetzung mit dem autoritativ-militaristischen Polizeihabitus im Kaiserreich und mit dem Versagen der Schutzmänner in den ersten Monaten der Republik, aber auch das immer wieder publizierte, teilweise erstaunlich eindeutige Bekenntnis nicht nur zu Bürgerbzw. Volksnähe, sondern auch zu Republik, Demokratie und vereinzelt sogar Sozialismus lassen dies durchaus plausibel erscheinen. Dass dies keine Einzelmeinungen waren, sondern von einer Vielzahl von Polizeibeamten so gesehen wurde, zeigt auch die am 8. September 1919 angenommene, von Heinrich Eiben wörtlich wiedergegebene Resolution des Reichsverbandes der Polizeibeamten Deutschlands, die gegen die Bildung der Sicherheitspolizei entschieden Protest erhob und dies folgendermaßen begründete: „Die Versammlung bezeichnet diesen Plan, […] der geeignet ist, Unzufriedenheit und Mißtrauen bei der breiten Masse der Bevölkerung gegen die Regierung zu erzeugen […] als einen bezeichnenden Rückschritt zur Reaktion und als Verletzung der von der Nationalversammlung dem freien deutschen Volke geschaffenen demokratischen Verfassung. Die Versammlung erwartet, daß die vom freien deutschen Volke bestellte Regierung die Rechte des Volkes schützen und für eine Neuorganisation der Polizei eintreten wird, die einer demokratischen Republik entspricht, und daß sie durch Beseitigung des überflüssigen Militarismus das Ansehen und den ehrlichen Friedenswillen des deutschen Volkes im In- und Auslande zur Geltung bringen wird.“802 Die Resolution kritisierte nicht nur den „überflüssigen Militarismus“ der Sicherheitspolizei, sondern betonte zudem explizit die Notwendigkeit, die „demokratische[n] Verfassung“ zu achten und eine Polizei zu schaffen, die den Anforderungen „einer demokratischen Republik“ genügte. Ein noch deutlicheres, unmissverständlicheres Plädoyer dieses Polizeiverbandes für Demokratie und Republik war kaum möglich. Trotz der Kritik aus der Polizeibeamtenschaft wurde die Reform der Polizei in dieser Form im Laufe des Jahres 1919 in Berlin und den meisten preußischen Provinzen in die Praxis umgesetzt, wobei oftmals ganze Freikorpseinheiten und Freiwilligenformationen in die Sicherheitspolizei 802 H. Eiben, Der Reichsverband der Polizeibeamten Deutschlands gegen die neue Sicherheitspolizei, in: ZDPol, 16. Jg. (1919/20), Nr. 13 (25.9.1919), S. 319. 1. Zusammenbruch und Neuaufbau (1918-23) 193 übernommen wurden.803 Dementsprechend verwundert es nicht, dass die Sicherheitspolizei zwar bei der Niederschlagung der kommunistischen Aufstände im Ruhrgebiet804 im April 1920 gut mit den eingesetzten Militärtruppen und Freikorpseinheiten harmonierte805, dass sie sich aber während des konterrevolutionären ‚Kapp-Lüttwitz-Putsches‘806 ab dem 13. März 1920 entweder neutral verhielt oder sogar eindeutig mit den Putschisten sympathisierte und damit ihren Aufgaben zum Schutz der staatlichen Ordnung nicht nachkam. Peter Leßmann-Faust kommt daher zu dem Ergebnis, dass „[d]ie preußische Sicherheitspolizei […] während des Kapp-Lüttwitz-Putsches die Probe auf ihre Loyalität zur demokratisch legitimierten Regierung nicht bestanden“ und „bei der gefährlichsten Bedrohung der frühen Weimarer Republik durch rechte Putschisten versagt“807 hat. Der bereits mehrfach erwähnte Breslauer Polizeiinspekteur und stellvertretende Vorsitzende der Vereinigung der staatlichen höheren Polizei- Exekutivbeamten Preußens Heinrich Eiben stellte in seinem am 13. Mai 1920 in der ZDPol erschienenen Beitrag zwar ohne direkte Bezugnahme, aber angesichts des zeitlichen Zusammenhangs vermutlich in Anspielung auf das Verhalten der Polizei während des Kapp-Lüttwitz-Putsches mit einer gewissen Süffisanz, aber auch mit erheblicher Verbitterung fest: „Ja, man denkt ganz unwillkürlich an die Ironie des Schicksals, wenn man sieht, daß gerade die Vertreter des Volkes, die den Soldaten in dem Polizisten bekämpft haben, nun eine Exekutivpolizei gründen, die ganz vom militärischen Geiste erfüllt ist und nach allen Äußerungen der Wirksamkeit auch diesen kräftig weiterpflegen wird. […] Was nützt uns die demokratischste Reichsverfassung, die sozialste Gesetzgebung, das vollkommenste Recht der Persönlichkeit, wenn die zu ihrer Ausführung, ihrem Vollzuge und ihrem Schutze bestellten Gewalten versagen, weil zwischen ihnen und der verantwortlichen Regierung sich widerstrebende Kräfte aller Art breitmachen können?“808 803 Vgl. J. Siggemann, Die kasernierte Polizei und das Problem der inneren Sicherheit in der Weimarer Republik – eine Studie zum Auf- und Ausbau des innerstaatlichen Sicherheitssystems in Deutschland 1918/19-1933, Freiburg i. Br. 1978, S. 82ff.; Leßmann-Faust, Geschichte der Polizei, S. 21. 804 Vgl. Eliasberg, Der Ruhrkrieg von 1920, S. 133ff.; Kolb, Deutschland, S. 60 f. 805 Vgl. Leßmann-Faust, Die Preußische Schutzpolizei, S. 60. 806 Kluge, Die Weimarer Republik, S. 62ff.; Thoß, Demokratie ohne Demokraten, S. 44 f.; Sturm, Weimarer Republik, S. 25 f. 807 Leßmann-Faust, Die Preußische Schutzpolizei, S. 76 und S. 74. 808 H. Eiben, Die Forderung des Tages, in: Führer der Polizeiexekutive, Beilage zu der ZDPol, 17. Jg. (1920/21), Nr. 4 (13.5.1920), S. 94. IV. Die deutsche Polizei in der Zwischenkriegszeit 194 Nach dem Scheitern des Putsches geriet die Sicherheitspolizei dementsprechend unter massiven politischen Druck. Dies führte zur Einsetzung von Zivilkommissaren der Gewerkschaften, die Kontrollfunktionen ausübten, und die Entlassung einer ganzen Reihe von als besonders antirepublikanisch eingeschätzten Offizieren der Sicherheitspolizei veranlassten. Allerdings stellte der neue sozialdemokratische preußische Innenminister Carl Severing die Existenz dieser Institution nicht grundsätzlich in Frage.809 Dies geschah dann allerdings am 22. Juni 1920 durch die ‚Boulogner Note‘ der Interalliierten Militär-Kontrollkommission, die die Sicherheitspolizei wegen ihrer starken militärischen Prägung als Versuch zur Umgehung der militärischen Restriktionen des Versailler Vertrags ansah, sie umgehend verbot und die Einrichtung einer stärker dezentralisierten und entmilitarisierten Polizei forderte.810 In der ZDPol wurde das Verbot der Sicherheitspolizei erstmals am 5. August 1920 erwähnt, als unter der Rubrik ‚Umschau‘ eine Eingabe des preußischen Ministers des Innern Carl Severing an den Reichsminister des Äußeren wiedergegeben wurde. In dieser drückte der Minister seinen Protest gegen diese Entscheidung der Interalliierten Militär-Kontrollkommission folgendermaßen aus: „Nunmehr stelle die Entente eine neue Forderung auf, die innere Organisation der Polizei betreffend. Dies stelle einen unerhörten Eingriff in die Hoheitsrechte der einzelnen Länder dar, zu dem aus dem Friedensvertrag keinerlei Berechtigung vorliege. […] Die Auflösung der Sicherheitspolizei […], die sich das Vertrauen der Bevölkerung, insbesondere auch des größten Teiles der Arbeiterschaft, erworben hat, und die die festeste Stütze des Staates und der Verfassung und den Hort der Ruhe und Ordnung des Landes bildet, müsse abgelehnt werden.“811 Angesichts der oben erörterten, von mehreren Autoren geäußerten Kritik an der geringen Bürgerorientierung der Sicherheitspolizei und ihres offensichtlichen Versagens während des Kapp-Lüttwitz-Putsches erscheint dieses positive Urteil über die Sicherheitspolizei wenig glaubhaft. Dies gilt vor allem für die hier von Carl Severing behauptete, hohe Akzeptanz der Si- 809 Vgl. Buder, Die Reorganisation der preußischen Polizei, S. 190ff.; Siggemann, Die kasernierte Polizei, S. 142ff.; Leßmann-Faust, Die Preußische Schutzpolizei, S. 69ff.; Leßmann-Faust, Weimarer Republik, S. 38 f. 810 Vgl. Liang, Die Berliner Polizei, S. 54; Bessel, Policing, S. 190; Leßmann-Faust, Die Preußische Schutzpolizei, S. 72ff.; Hartewig, »Eine sogenannte Neutralität der Beamten gibt es nicht«, S. 321. 811 C. Severing, Protest gegen die Auflösung der Sicherheitspolizei, in: ZDPol, 17. Jg. (1920/21), Nr. 10 (5.8.1920), S. 220. 1. Zusammenbruch und Neuaufbau (1918-23) 195 cherheitspolizei in der Arbeiterschaft, die ziemlich abwegig erscheint und der gängigen Literaturmeinung diametral entgegensteht, wie weiter unten noch genauer erörtert werden wird.812 Die Tatsache, dass diese ministerielle Eingabe zu einer für die Polizei ohne jeden Zweifel hochrelevanten Entwicklung an wenig prominenter Stelle in der ZDPol erwähnt und dass auf jegliche Kommentierung verzichtet wurde, deutet sicherlich ebenfalls darauf hin, dass Zweifel an der Glaubwürdigkeit dieser Einschätzung des preußischen Innenministers geboten waren. Letztlich blieb dieser Protest aber folgenlos, so dass am 4. Oktober 1920 die Sicherheitspolizei aufgelöst werden musste. Einrichtung einer Einheitspolizei Unmittelbar nach der ‚Boulogner Note‘ begann man im Preußischen Innenministerium mit den Planungen für die Errichtung einer neuen Polizei, die sowohl der angespannten Sicherheitslage als auch den Vorgaben der Alliierten in angemessener Weise Rechnung tragen sollte.813 Im Ergebnis führte dies zu einer vom sozialdemokratischen preußischen Innenminister Carl Severing und seinem Mitarbeiter und späteren Staatssekretär Wilhelm Abegg entwickelten Organisationsrichtlinie für die preußische Polizei, die in nahezu unveränderter Form auch in den übrigen Ländern des deutschen Reichs umgesetzt wurde und die das deutsche Polizeiwesen sehr nachhaltig geprägt hat. Der entsprechende, am 20. November 1920 veröffentlichte, sehr umfangreiche Erlass814 sah die Zusammenfassung der bisherigen Ordnungs- und Sicherheitspolizei zu einer straff gegliederten Einheitspolizei vor, die als Schutzpolizei firmieren und zusammen mit der in größeren Kommunen angesiedelten Kriminalpolizei für Sicherheit und Ordnung in Deutschland sorgen sollte. Unterstützt wurde sie dabei von der insbesondere für das Meldewesen sowie Gewerbe- und Gesundheitsinspektionen zuständigen Verwaltungspolizei, den in dünn besiedelten, ländlichen Gebieten im Einzeldienst tätigen Landjägern und der für nachc) 812 Leßmann-Faust, Die Preußische Schutzpolizei, S. 79; Hartewig, »Eine sogenannte Neutralität der Beamten gibt es nicht«, S. 315ff.; Liang, Die Berliner Polizei, S. 54ff. 813 Vgl. Leßmann-Faust, Weimarer Republik, S. 36 f.; Schmidt, Sicherheit in stürmischen Zeiten, S. 34ff. 814 Vgl. o. V., Die Auflösung der Sicherheitspolizei und Umbildung der Polizei in Preußen, in: ZDPol, 17. Jg. (1920/21), Nr. 16 (28.10.1920), S. 334ff. IV. Die deutsche Polizei in der Zwischenkriegszeit 196 richtendienstliche Tätigkeiten zuständigen politischen Polizei.815 Die Kernbestimmung dieses Erlasses – nämlich die Einrichtung einer im Wesentlichen aus Schutz- und Kriminalpolizei bestehenden Einheitspolizei – ist auch heute noch das zentrale Strukturmerkmal der deutschen Länderpolizeien. Im Mittelpunkt der neuen Weimarer Polizei stand die Schutzpolizei, die mit großem Abstand den Großteil des Personalkörpers ausmachte und für alle polizeilichen Aufgabenbereiche zuständig war, die nicht explizit einem anderen Teilbereich der Polizei zugewiesen waren. Die Personalstärke der Polizei ergab sich direkt aus den Vorgaben der Interalliierten Militär-Kontrollkommission und betrug insgesamt 150.000 Mann, von denen 85.000 Mann auf Preußen entfielen, was angesichts der für die Reichswehr geltenden Begrenzung auf 100.000 Mann eine beträchtliche Größenordnung darstellte und die Polizei zu einer „ernstzunehmende[n] Konkurrenz der Reichswehr“816 machte.817 Die zentrale Bedeutung der Schutzpolizei im Weimarer Polizeisystem wird in Abbildung 11 verdeutlicht.818 Personalstärke der preußischen Polizei 1920Abb. 11: 815 Vgl. Buder, Die Reorganisation der preußischen Polizei, S. 305ff. 816 Knatz, Polizei in der Weimarer Republik, S. 39. 817 Vgl. P. Leßmann-Faust, Reichswehr und preußische Schutzpolizei im ersten Jahrfünft der Weimarer Republik, in: P. Nitschke [Hrsg.], Die deutsche Polizei und ihre Geschichte – Beiträge zu einem distanzierten Verhältnis, Hilden 1996, S. 121ff. 818 Vgl. Leßmann-Faust, Geschichte der Polizei, S. 21 f. 1. Zusammenbruch und Neuaufbau (1918-23) 197 So entfiel mit 55.000 Mann mehr als 60% der Gesamtstärke der preußischen Polizei auf die Schutzpolizei, von denen etwa die Hälfte in festen Verbänden (‚Hundertschaften‘) kaserniert waren, während die Verwaltungspolizei und die Landjäger lediglich jeweils weniger als 10% und die Kriminalpolizei sogar nur ca. 3% der Gesamtstärke ausmachten. Die zunächst noch relativ hohe Zahl am kommunalen Polizeibeamten ging in den folgenden Jahren deutlich zurück.819 Bis auf einige eher marginale administrative Anpassungen, die auf Druck der Interalliierten Militär-Kontrollkommission bis 1922 durchgeführt wurden und die im Wesentlichen in der Umbenennung von Organisationseinheiten und einer stärkeren Einbindung der kasernierten Schutzpolizeieinheiten in den alltäglichen Revierdienst bestanden, hatte die Polizei der Weimarer Republik nun ihre endgültige Form gefunden.820 In der ZDPol fanden das Verbot der Sicherheitspolizei und die sich daran anschließenden Planungen zur umfassenden Neugestaltung der Polizei ihren Niederschlag in einer Reihe von Beiträgen des bereits mehrmals zitierten Breslauer Polizeiinspektors und stellvertretenden Vorsitzende der Vereinigung der staatlichen höheren Polizei-Exekutivbeamten Preußens Heinrich Eiben in der zweiten Hälfte des Jahres 1920, der als verantwortlicher Schriftleiter einer in diese Zeitschrift integrierten Beilage in nahezu jedem Heft zu Wort kam. Den Anfang machte sein Beitrag mit dem Titel „Die Einheitspolizei – Ein Vorschlag zu ihrer Bildung“ vom 22. Juli 1920, in dem er sich mit dem Ursachen für den unbefriedigenden Zustand der Polizei beschäftigte und dann Vorschläge für die anstehende Reorganisation der Polizei machte.821 Dabei waren weniger seine Vorschläge interessant, die den später erscheinenden Reorganisationsplänen von Carl Severing und Wilhelm Abegg allerdings erstaunlich ähnlich waren, sondern vielmehr seine Begründung der Notwendigkeit einer Neugestaltung der Polizei. So vermied er jeden Hinweis auf das von der Interalliierten Militär- Kontrollkommission ausgesprochene Verbot der Sicherheitspolizei und versuchte stattdessen den Eindruck zu erwecken, dass der Impuls für die nun anstehende Reorganisation der Polizei aus der Polizei selbst gekommen wäre. 819 Vgl. Leßmann-Faust, Geschichte der Polizei, S. 21 f.; Leßmann-Faust, Weimarer Republik, S. 37. 820 Vgl. Buder, Die Reorganisation der preußischen Polizei, S. 443ff.; Leßmann- Faust, Die Preußische Schutzpolizei, S. 88ff. 821 Vgl. Eiben, Die Einheitspolizei – Ein Vorschlag zu ihrer Bildung (22.7.1920), S. 205 f. IV. Die deutsche Polizei in der Zwischenkriegszeit 198 „Bei der Umgestaltung der Exekutivpolizei häufen sich die Beweise für die Richtigkeit der von ihren Organisationen und insbesondere von unserer Vereinigung immer wieder aufgestellten Behauptung, daß die Aufgaben der Vollzugspolizei restlos und wirkungsvoll nur von einer Einheitspolizei erfüllt werden können und es verfehlt ist, zwischen die beiden bisher in engster Gemeinschaft miteinander verbundenen Organe, die Schutzmannschaft und die Kriminalpolizei, die Sicherheitspolizei zu schieben, ohne für eine Verbindung zu sorgen, die Gewähr bietet, daß sie nicht nur durch äußere Macht zusammengehalten werden, sondern sich auch im innersten Wesen als gleichwertige und gleichberechtigte Glieder eines Berufes fühlen, die berufen sind, Hand in Hand für den Bestand der öffentlichen Sicherheit, Ruhe und Ordnung zu sorgen.“822 Zudem veränderte er seine Argumentation im Vergleich zu seinen früheren, oben erörterten Beiträgen zu diesem Thema, die sehr deutlich die starke militärische Ausrichtung der Sicherheitspolizei kritisierten und ihre Defizite in Bezug auf Bürgerorientierung hervorhoben. Stattdessen betonte er in diesem Aufsatz nun die Notwendigkeit der Bildung einer ‚Einheitspolizei‘ und fokussierte seine Kritik sehr stark auf die Probleme, die sich aus der Koexistenz von mehreren Polizeien ergeben könnten. Auch wenn er diesen Aspekt in seinen früheren Beiträgen durchaus erwähnt hatte, so war die veränderte Gewichtung in seiner Argumentation sowie der Verzicht auf die in seinen früheren Beiträgen üblichen Plädoyers für eine bürgernahe, zivile, demokratischen Werten verpflichtete Polizei doch sehr auffällig. Über die Ursachen für die veränderte Argumentation kann natürlich nur spekuliert werden, allerdings erscheint es plausibel anzunehmen, dass Heinrich Eiben befürchtete, dass sich ein klares Bekenntnis für eine bürgerorientierte, entmilitarisierte Polizei zum damaligen Zeitpunkt – d. h. Ende Juli 1920 – negativ auf die Akzeptanz seiner Vorschläge zur Reorganisation der Polizei auswirken könnte. So galt insbesondere der preußische Innenminister Carl Severing im linken politischen Spektrum und in der Arbeiterschaft als „ausgesprochene Reizfigur“823, dem in seiner Biografie „ein gewisses Faible für das Militärische“824 zugeschrieben wird. Insofern kann davon ausgegangen werden, dass die für die Neugestaltung der Polizei zuständigen Entscheidungsträger in den entsprechenden Ministerien 822 Eiben, Die Einheitspolizei – Ein Vorschlag zu ihrer Bildung (22.7.1920), S. 205. 823 Schmidt, Schützen und Dienen, S. 48. 824 T. Alexander, Carl Severing – Sozialdemokrat aus Westfalen mit preußischen Tugenden, Bielefeld 1992, S. 156. 1. Zusammenbruch und Neuaufbau (1918-23) 199 stark daran interessiert waren, eine militärisch schlagkräftige Polizei zu errichten, die die vom links- wie rechtsextremen politischen Spektrum ausgehenden gewaltsamen Unruhen und Aufstände kurzfristig und effektiv bekämpfen konnte.825 Knapp zwei Monate später – am 1. Oktober 1920 – wurde Heinrich Eiben in seinem Beitrag mit dem Titel „Es tagt!“ schon sehr viel deutlicher und äußerte sich geradezu euphorisch in Bezug auf die geplante Neugestaltung der Polizei. „Nach langen Wehen schlägt endlich die Geburt der ‚Einheitspolizei‘. Nach fast unendlich erscheinender, sturmbewegter und dunkler Nacht erblicken wir am Horizont unseres Himmels die Morgenröte. […] Zur Erneuerung der Freiheit und Gerechtigkeit, zum Dienste für den inneren und äußeren Frieden und zur Förderung des gesellschaftlichen Fortschritts will [der deutsche Staat] sich Kräfte und Werkzeuge schaffen, die einheitlich in ihrem inneren Wesen, ihrer äußeren Form und ihrer ganzen Zusammenfassung die gleichmäßige Durchführung des staatlichen Willens und den Schutz der geschaffenen Werke und Werte der Besseren unseres Volkes gewährleisten. So bringt der sonst allen Deutschen äußerst nachteilige und unbequeme Druck unserer Feinde wenigstens die lange entbehrte und noch viel länger äußerst notwendige einheitliche und volkstümlichere Gestaltung des Polizeiwesens.“826 Der Autor erkannte nicht nur an, dass die nun von ihm so überschwänglich gefeierten Reorganisationspläne für die Polizei nur auf Druck der Interalliierten Militär-Kontrollkommission zu Stande gekommen waren, sondern er kritisierte zudem das seiner Meinung nach nicht zweckmäßige, unzeitgemäße bisherige Polizeiwesen, wobei unklar blieb, ob er damit die bisherige Sicherheitspolizei oder sogar die Polizei des untergegangenen Kaiserreichs meinte. Interessant ist insbesondere, dass Heinrich Eiben zunächst nicht genau erläuterte, warum er von der Reform so begeistert war. Als Vorteile der neuen Struktur benannte er lediglich ihre Einheitlichkeit und ihre ‚Volkstümlichkeit‘, wobei sich im weiteren Verlauf des Beitrags dann herausstellte, dass er mit dem letztgenannten Begriff eine stärkere Bürgerorientierung der Polizei über alle Bevölkerungsschichten hinweg meinte. Seine enorme Begeisterung für die anstehende Reorganisation der 825 Vgl. Bessel, Militarisierung und Modernisierung, S. 325 f.; Schmidt, Schützen und Dienen, S. 72. 826 H. Eiben, Es tagt! in: Führer der Polizeiexekutive, Beilage zu der ZDPol, 17. Jg. (1920/21), Nr. 14 (1.10.1920), S. 306. IV. Die deutsche Polizei in der Zwischenkriegszeit 200 Polizei wohl vor allem darauf zurückzuführen, dass er zu diesem Zeitpunkt bereits einen ersten Entwurf der von Carl Severing und Wilhelm Abegg geplanten Reorganisation einsehen konnte und dabei festgestellt hatte, dass diese Pläne weitgehend seinen in früheren Publikationen bereits dargestellten Vorstellungen einer Einheitspolizei entsprachen. „Soweit uns bisher Einsicht in den Abegg’schen Entwurf gegeben worden ist, macht er den Eindruck eines großzügigen, allen Bedürfnissen Rechnung tragenden Werkes. Es macht seinem Meister alle Ehre und zeugt von ebensoviel Sachkunde wie von dem Streben nach Vollkommenheit.“827 Trotz seiner grundsätzlichen und nahezu uneingeschränkten Unterstützung für diese Reformpläne stellte er weiter unten in seinem Beitrag fest, dass sie auch eine Schwäche enthielt, die es möglichst zu beseitigen galt. So hatte er „Zweifel an der inneren Harmonie“ der neu entstehenden Polizei, wobei er sich allerdings bei seinen sehr ausführlichen Erläuterungen der genauen Ursachen für diese Zweifel sehr vorsichtig und vage ausdrückte, so dass diese letztlich unklar blieben. Wie die folgenden Ausführungen verdeutlichten, deuteten seine Ausführungen darauf hin, dass ihm die weiterhin starke militärische Prägung der Polizei, aber auch die ablehnende Haltung von Teilen der Polizeibeamtenschaft zur demokratischen Grundordnung der neuen Republik offensichtlich Sorgen bereiteten, und dass er Schwierigkeiten bei der Zusammenarbeit von jüngeren Sicherheitspolizisten mit militärischen Hintergrund und älteren Ordnungspolizisten bzw. ehemaligen Schutzmännern sowie eine Benachteiligung des letztgenannten Personenkreises gegenüber dem erstgenannten befürchtete. „Hierbei müssen die Lehren aus dem Zerfalle unseres Vaterlandes nutzbar gemacht werden. Klassenhaß war die Hauptursache unseres Unterganges. Versöhnung der Stände ist die Vorbedingung zum Aufstieg. Überhebung und Mißachtung trennte Führer und Masse, Dünkel und Neid ließ die Harmonie zwischen Berufsangehörigen nicht aufkommen. […] Herkunft, Erziehung, Ausbildung, Vermögen sind die Wertmesser, nicht, wie allein es richtig ist, die tatsächlichen Eigenschaften und Leistungen. […] Diesen auch bei den Angehörigen unseres Berufes zu stark verbreiteten Mißbrauch zu beseitigen, ist das erste Gebot. Leicht wird diese Aufgabe nicht sein. Heißt es doch mit tief eingewurzelten Traditionen, alten Vorurteilen und mächtigen Partei- 827 Eiben, Es tagt! (1.10.1920), S. 306. 1. Zusammenbruch und Neuaufbau (1918-23) 201 dogmen aufzuräumen. […] Die Kräfte, die den neuen Apparat bedienen sollen, werden sich im wesentlichen zusammensetzen aus bisherigen Berufspolizisten und aus Soldaten […]. Der Lauf der Dinge hat die früher so freundschaftlich miteinander verbundenen Brüder fast zu Gegnern gemacht und in beiden Lagern Vorgesetzte und Untergebene über das zuträgliche Maß hinaus geschieden. Von allen Kräften kann aber auch nicht eine entbehrt werden, jede aber ihren Fähigkeiten und Verdiensten entsprechend Betätigung und Entlohnung finden. Die Abegg’sche Denkschrift bestätig diese Behauptung, läßt aber insofern Gerechtigkeit vermissen, als die Angehörigen der alten Polizei […] nicht richtig gewertet worden sind. […] Sie werden nicht nur die mit Recht nach Anerkennung dürstenden älteren Polizisten kränken, sondern in dem neuen Exekutivkörper den Frieden nicht aufkommen lassen, dessen er so dringend bedarf.“828 Heinrich Eibens äußerst behutsame, teilweise äußerst verwirrend formulierte Ausführungen, bei denen er wohl jede Schuldzuweisung oder Kränkung vermeiden wollte, sollten wohl eine weitere Belastung der Beziehungen zwischen ehemaligen Ordnungs- und Sicherheitspolizisten vermeiden und damit die Zusammenarbeit als Einheits- bzw. Schutzpolizei erleichtern. Gleichwohl sah er offensichtlich Anlass zur Kritik, die er aber teilweise so abstrakt und zaghaft formulierte, dass sie nahezu unverständlich wurde. Vor dem Hintergrund seiner früheren, oben erörterten Beiträge, in denen er sehr deutlich eine Demokratisierung der Polizei forderte und die Sicherheitspolizei wegen ihrer militärischen Prägung und ihrer mangelhaften Bürgerorientierung kritisierte, konnte allerdings vermutet werden, dass dies auch hier ein Anliegen war. Relativ deutlich wurde er nur in Bezug auf die befürchtete ökonomische Benachteiligung der älteren, ehemaligen Ordnungspolizisten, während die genauen Bezüge des ersten Teils seiner Kritik, in dem er die Missstände im Wilhelminischen Klassenstaat ansprach, zur geplanten Reorganisation der Polizei unklar blieben und in sich nicht schlüssig waren. So waren der von ihm kritisierte „Klassenhaß“ oder der „Dünkel und Neid“ unter Polizeibeamten sicherlich auf die polizeilichen Strukturen des Kaiserreichs bezogen. Dies ließ sich aber nur schwer in Einklang bringen mit seiner Feststellung, dass „die früher so freundschaftlich miteinander verbundenen Brüder“ zwischenzeitlich eher „zu Gegnern“ geworden seien, da mit „früher“ eigentlich nur die von 828 Eiben, Es tagt! (1.10.1920), S. 307 f. IV. Die deutsche Polizei in der Zwischenkriegszeit 202 „Dünkel und Neid“ unter den Polizeikollegen geprägte und damit eben alles andere als ‚brüderliche‘ Kaiserzeit gemeint sein konnte. Etwas deutlicher wurde er in seinem sechs Wochen später – d. h. am 16. November 1920 – in der ZDPol erschienenen Beitrag mit dem Titel „Kritische Betrachtungen“, in dem er zunächst wieder die anstehende Reorganisation der Polizei lobte und dann feststellte: „Rückhaltlos bekennen auch wir uns zu dieser Auffassung, vermissen aber das außerdem unbedingt nötige Verständnis für die tieferen Ursachen, die unser Volk auseinandergerissen und die gegenwärtigen ganz unhaltbaren Zustände erzeugt haben. Es sind nicht allein die Wirkungen des verlorenen Krieges, sondern auch die schon vor dem Kriege in einem reichen und mächtigen Deutschland wuchernden Mißstimmungen über unzureichende Maßnahmen zum Schutze der Armen und Schwachen. […] Alles steht im Banne der jüngsten Ereignisse, für die Erinnerung an die Mißstände der Zeit vor dem Kriege ist kaum noch Raum. Und wie oft sind damals die Mißstände beklagt, wie häufig ist uns der Vorwurf der Rückständigkeit, der Verständnislosigkeit und des Mangels an gutem Willen gemacht worden! […] Diesen gewaltigen Mangel scheint man ganz vergessen zu haben. Mag der Abeggsche Entwurf diese Annahme auch weniger rechtfertigen, seine Ausführung begründet sie immer deutlicher, und namentlich die Besoldung der für sehr wichtige und schwierige Arbeiten bestimmten Beamten erhärtet die Überzeugung, daß den maßgebenden Stellen das rechte Verständnis für die Bedeutung dieser Beamten fehlt.“829 In diesem Beitrag kritisierte er nun wieder recht deutlich die Zustände im Wilhelminischen Klassenstaat und betonte die Notwendigkeit einer stärkeren Bürgerorientierung der Polizei, um den aktuellen politischen und gesellschaftlichen Rahmenbedingungen in der Weimarer Republik zu entsprechen. In letzten Satz der oben zitierten Passage verlagerte er seine Argumentation dahingehend, dass er die Besoldung von bestimmten Polizeibeamten für unangemessen hielt. Welche Beamten er meinte, blieb zunächst unklar, bis er dann weiter unten klarstellte: „Wenden wir unsere Gedanken wieder der Neuordnung zu, so beschäftigt uns als erstes immer erneut die geringwertige Einschätzung, die der Leiter eines Einheitsreviers mit seinen vielgestaltigen und für einen 829 H. Eiben, Kritische Betrachtungen, in: Führer der Polizeiexekutive, Beilage zu der ZDPol, 17. Jg. (1920/21), Nr. 17 (16.11.1920), S. 361. 1. Zusammenbruch und Neuaufbau (1918-23) 203 großen Personenkreis […] maßgebenden Aufgaben gegenüber dem Führer einer Hundertschaft gefunden hat.“830 Legt man den Fokus auf diesen letzten Satz, dann zielte die Kritik von Heinrich Eiben an der geplanten Reform unmittelbar auf die seiner Meinung nach unangemessen niedrige Besoldung der Leiter von Polizeirevieren im Vergleich zu den Führern von Hundertschaften ab. Betrachtet man aber auch seine vorherigen Sätze, dann wird deutlich, dass seine Kritik darüber hinaus ging und er anscheinend nicht nur eine finanzielle, sondern eine generelle Benachteiligung der für den klassischen Streifendienst in den Revieren zuständigen, täglich in direktem Kontakt mit dem Bürger stehenden Polizeibeamten gegenüber der kasernierten, militärisch geprägten, für größere Gefährdungslagen zuständigen Hundertschaften beklagte. Gerade vor dem Hintergrund seiner früheren, oben erörterten Beiträge in der ZDPol, in denen er die Errichtung der stark militärisch orientierten Sicherheitspolizei kritisierte und sehr eindringlich für eine zivile, bürgernahe, entmilitarisierte Polizei eintrat, erscheint es plausibel anzunehmen, dass sich seine Kritik durchaus auch auf den immer deutlicher werdenden, weiterhin stark ausgeprägten militärischen Charakter der gerade entstehenden Einheits- bzw. Schutzpolizei bezog. Dass Heinrich Eibens Befürchtungen gerechtfertigt waren, zeigte sich dann bei der Umsetzung der Reform der Polizei in den folgenden Monaten. Insbesondere die Kasernierung der jungen, am Beginn ihrer beruflichen Laufbahn stehenden Polizeibeamten in ‚Polizei-Bereitschaften‘ sowie ihre Organisation in festen Verbänden (Hundertschaften) und ihre relativ schwere Bewaffnung spiegelten den weiterhin vorhandenen militärischen Charakter der Schutzpolizei wider, der aufgrund der schwierigen Sicherheitslage und der instabilen innenpolitischen Verhältnisse von der Regierung für unverzichtbar gehalten wurde.831 Verstärkt wurde dieser militärische Charakter der Polizei durch den hohen Anteil an militärisch geschultem und oftmals sogar fronterfahrenem Personal, so dass es „[w]ährend der Weimarer Zeit […] kaum Polizeibeamte [gab], die vorher ein normales, ziviles Arbeitsverhältnis gehabt hatten“832. Insofern kann man durchaus die Ansicht vertreten, dass die in der ‚Boulogner Note‘ von der Interalliierten Militär-Kontrollkommission geforderte Abschaffung der Sicherheitspolizei „als zweite Reichswehr“833 und die Einrichtung einer stärker entmilitari- 830 Eiben, Kritische Betrachtungen (16.11.1920), S. 361. 831 Vgl. Leßmann-Faust, Die Preußische Schutzpolizei, S. 83ff. 832 Bessel, Militarisierung und Modernisierung, S. 325. 833 Vgl. Leßmann-Faust, Geschichte der Polizei, S. 21. IV. Die deutsche Polizei in der Zwischenkriegszeit 204 sierten Polizei strenggenommen nicht stattfand. Durch die Verschmelzung der ‚grünen‘ Sicherheitspolizei mit der ‚blauen‘ Ordnungspolizei entstand mit der Schutzpolizei allerdings eine Institution, deren militärischer Charakter weniger deutlich hervortrat. In diesem Sinne stellt auch Peter Leßmann-Faust fest, dass die „‚Auflösung der Sicherheitspolizei‘ […] nicht darüber hinweg täuschen [konnte], daß diese, mit dem neuen Namen ‚Schutzpolizei‘ versehen […], weiterbestand“834. Akzeptanzdefizite des polizeilichen Streifendienstes Stand bisher eher die institutionelle Entwicklung der Polizei in den ersten Nachkriegsjahren im Mittelpunkt, so soll nun im Folgenden der Analysefokus stärker auf die praktische Polizeiarbeit ausgerichtet werden. Dabei bietet es sich an, zunächst den polizeilichen Streifendienst zu betrachten, der traditionell das Haupttätigkeitsfeld der meisten Polizeibeamten darstellt und daher als „Rückgrat“ des beruflichen Alltags im schutzpolizeilichen Bereich gilt.835 Dieser auch als polizeilicher Einzeldienst bezeichnete Aufgabenbereich dient in der Regel als Sammelkategorie für das schutzpolizeiliche Alltagshandeln, d. h. für all jene Tätigkeiten, „die von den nicht spezialisierten Außendienstkräften der polizeilichen Regionaldienststellen eigenverantwortlich wahrgenommen werden“836. Neben der Gefahrenabwehr und der Verfolgung von Straftaten („auf frischer Tat“) geht es beim Streifendienst vor allem um Verkehrssicherheitsaufgaben (z. B. Verkehrsunfallaufnahmen), Konfliktschlichtungen (z. B. Nachbarschaftsstreitigkeiten) sowie verschiedene Service-Dienstleistungen und allgemeine Hilfeleistungen (z. B. Rückführung entlaufener Kinder), so dass man etwas überspitzt vom Streifenbeamten als polizeilichem „Mädchen für alles“837 sprechen könnte. Einen allgemeinen Einblick in den polizeilichen Streifendienst in den Anfangsjahren der Weimarer Republik gab ein im Dezember 1921 in der ZDPol publizierter Beitrag des an der Höheren Polizeischule in Eiche tätid) 834 Leßmann-Faust, Die Preußische Schutzpolizei, S. 92. 835 Vgl. W. Geck, Streifen- und Bezirksdienst, in: M. Kniesel, E. Kube, M. Murck [Hrsg.], Handbuch für Führungskräfte der Polizei – Wissenschaft und Praxis, Lübeck 1996, S. 262ff.; Feltes, Polizeiliches Alltagshandeln, Effektivität und Bürgernähe, S. 139ff. (Zitat: S. 145); Bayley, What do the police do? S. 141ff.; Thibault, Lynch, McBride, Proactive Police Management, S. 197ff. 836 Geck, Streifen- und Bezirksdienst, S. 248. 837 Kniesel, Staatsaufgabe Sicherheit, Grundgesetz und Polizei, S. 81. 1. Zusammenbruch und Neuaufbau (1918-23) 205 gen Polizeimajors Paul Schmidt mit dem Titel „Der Streifendienst“.838 Dieser begann folgendermaßen: „Im Gegensatz zu dem Postendienste, der im ganzen eine Spezialtätigkeit darstellt, steht der Dienst der Streifen mit seinem alles umfassenden Wirken und Schaffen. Für Sicherheit, Ruhe und Ordnung, Reinlichkeit und Bequemlichkeit zu sorgen ist Aufgabe der Straßenstreifen. Um sie zu erfüllen, müssen die Beamten nach allen Seiten hin die Augen offen halten. Ein gut geschulter Polizeibeamter im Straßendienste muß alles sehen, er muß sofort erkennen, ob etwas verboten oder nicht verboten ist, ob eine strafbare Handlung vorliegt oder ob ein polizeiliches Eingreifen im Verwaltungswege notwendig ist.“839 Dabei wies der Autor, der zudem Autor eines Lehrbuchs zu diesem Themenfeld war840, direkt zu Beginn auf die bestimmenden Merkmale des Streifendienstes hin, nämlich funktionale Breite, Generalistentum und präventiver Charakter, die sich bis in die heutige Zeit erhalten haben.841 Der Streifendienst bestand im Wesentlichen darin, einen bestimmten regionalen Zuständigkeitsbereich nicht-anlassbezogen zu ‚bestreifen‘ und dabei ‚die Augen offen zu halten‘. Auf diese Weise konnte der Streifenbeamte zum einen auf von ihm bemerkte Störungen der öffentlichen Ordnung reagieren und zum anderen Präsenz zeigen. Im weiteren Verlauf des Beitrags umschrieb der Autor dann die im Streifenalltag am häufigsten vorkommenden Anlässe für ein polizeiliches Einschreiten. Hierzu gehörten Störungen des öffentlichen Straßenverkehrs sowie davon ausgehende Gefährdungen der Bevölkerung, Eigentumsdelikte, allgemeine Auskünfte gegen- über der Bevölkerung sowie Eingriffe „[ü]berall, wo Menschenleben sich in Gefahr befinden oder gefährdet werden können“, beispielsweise „durchgehende Gespanne aufzuhalten“ oder „verlaufene Kinder zu Wache zu bringen“842. Auch wenn in diesem Beitrag eine Quantifizierung der Anteile der einzelnen Tätigkeitsfelder nicht erfolgte, so deuteten doch die Ausführlichkeit, mit der bestimmte Aufgaben behandelt wurden, sowie die zur Veranschaulichung angeführten Beispiele darauf hin, dass der Streifen- 838 Vgl. P. Schmidt, Der Streifendienst, in: ZDPol, 18. Jg. (1921/22), Nr. 18 (20.12.1921), S. 388 f. 839 Schmidt, Der Streifendienst (20.12.1921), S. 388. 840 Vgl. P. Schmidt, Der praktische Dienst der Straßenpolizei – Ein Handbuch für den Unterricht und Selbstunterricht der Beamten der Schutzpolizei, Berlin 1922. 841 Vgl. Feltes, Polizeiliches Alltagshandeln, Effektivität und Bürgernähe, S. 139ff. 842 Schmidt, Der Streifendienst (20.12.1921), S. 389. IV. Die deutsche Polizei in der Zwischenkriegszeit 206 dienst überwiegend durch wenig spektakuläre, weitgehend ungefährliche verkehrspolizeiliche und beratende Tätigkeiten sowie die Ahndung von Bagatelldelikten geprägt war. Das Verhalten der für die Aufrechterhaltung der öffentlichen Ordnung zuständigen Streifenbeamten war in den ersten Jahren der Weimarer Republik dementsprechend in der Regel unspektakulär und fand auch nur selten größere Beachtung in der Öffentlichkeit.843 Wenn dies aber geschah, dann wurde es Karin Hartewig zufolge von der Bevölkerung „häufig als unangemessen und ohne Gespür für die Situation“844 wahrgenommen. Kritisiert wurden insbesondere das autoritäre Auftreten von Polizeibeamten gegenüber den Angehörigen der unteren Bevölkerungsschichten, aber auch der unangemessene, zu rasche Waffengebrauch sowie die Misshandlung von Verhafteten.845 Damit setzten sich die bereits im Kaiserreich bestehende, negative Einstellung des Arbeitermilieus zur Polizei und das von Angst, Ablehnung und Verachtung geprägte Verhältnis auch in der Weimarer Republik offensichtlich fort.846 Eine wichtige Ursache für dieses inad- äquate, teilweise vermutlich auch rechtswidrige Verhalten der Polizei, das in der Regel für die Beamten ohne rechtliche oder disziplinarische Konsequenzen blieb, dürfte wohl die militärische Sozialisation der meisten Polizeibeamten in den Weltkriegsjahren in der Reichswehr und anschließend in Freikorps gewesen sein, die eine bürgerorientierte, möglichst gewaltlose Polizeiarbeit nachhaltig erschwerte.847 Ebenfalls eine Rolle dürften aber auch andere Faktoren gespielt haben, z. B. eine gewisse Überforderung der Polizei aufgrund der angespannten Personal- und Finanzmittelausstattung in den ersten Nachkriegsjahren sowie Defizite im polizeilichen Rekrutierungs-, Aus- und Fortbildungswesen.848 Das Verhältnis zwischen den Streifenpolizeibeamten und der Bevölkerung wurde in der ZDPol regelmäßig thematisiert, was an sich schon ein Indiz dafür ist, dass es sich hierbei um ein nicht unproblematisches Thema handelte. So dürfte beispielsweise die am 31. Juli 1919 in dieser Zeitschrift 843 Vgl. Knatz, Polizei in der Weimarer Republik, S. 44. 844 Hartewig, »Eine sogenannte Neutralität der Beamten gibt es nicht«, S. 315. 845 Vgl. Hartewig, »Eine sogenannte Neutralität der Beamten gibt es nicht«, S. 315ff. 846 Vgl. Jessen, Polizei im Kaiserreich, S. 25; Funk, Die Entstehung der Exekutivpolizei, S. 21 f.; Leßmann-Faust, Die Preußische Schutzpolizei, S. 79; Liang, Die Berliner Polizei, S. 28ff. 847 Vgl. Funk, Die Entstehung der Exekutivpolizei, S. 22; Hartewig, »Eine sogenannte Neutralität der Beamten gibt es nicht«, S. 322. 848 Vgl. Bessel, Militarisierung und Modernisierung, S. 339ff. 1. Zusammenbruch und Neuaufbau (1918-23) 207 wörtlich wiedergegebene Dienstanweisung des Berliner Polizeipräsidenten Eugen Ernst für die Berliner Polizei, die sich mit der Art und Weise des Umgangs mit dem „Publikum“ beschäftigte, vermutlich eine Reaktion auf entsprechende Probleme, beispielsweise Beschwerden der Bevölkerung oder polizeikritische Berichte in der Presse, gewesen sein.849 In dieser Dienstanweisung wurde unter anderem angeführt: „Die Polizeibeamten sollen gegen das Publikum höflich, zuvorkommend und hilfsbereit sein und sich jeder Belästigung desselben durch Kleinlichkeit, unnötige Strenge oder durch Einmischung in Angelegenheiten, die den Dienst nicht berühren, enthalten. […] Wird aber ein nachdrückliches Einschreiten des Beamten erforderlich, so darf sein Benehmen bei aller Entschiedenheit niemals anmaßend, schroff oder verletzend sein. […] Körperlicher Zwang ist nur im Fall dringender Notwendigkeit und auch dann nur schonend und mit Mäßigung anzuwenden. Energie ist keineswegs gleichbedeutend mit Grobheit und Härte, und erfahrungsgemäß folgt auch das Publikum den polizeilichen Anordnungen um so bereitwilliger, je ruhiger und maßvoller der Polizeibeamte auftritt.“850 Allein schon die Tatsache, dass diese aus heutiger Sicht selbstverständlich anmutenden Verhaltensregeln explizit in einer Dienstanweisung formalisiert und in einer der führenden polizeilichen Fachzeitschriften publiziert wurden, spricht dafür, dass Höflichkeit und Hilfsbereitschaft für die damalige Polizei eben keine Selbstverständlichkeit waren. Vielmehr ist davon auszugehen, dass gerade die explizite Erwähnung von Verhaltensweisen, die Berliner Polizeibeamte vermeiden sollten bzw. die Eugen Ernst als Polizeipräsident für unangemessen hielt, mit hoher Wahrscheinlichkeit auf tatsächlich existierende Missstände hindeuteten, und dass dementsprechend ‚kleinliche‘, ‚unnötig strenge‘, ‚anmaßende‘, ‚schroffe‘, ‚verletzende‘ oder ‚grobe‘ Verhaltensweisen von Polizeibeamten in ihren alltäglichen Interaktionen mit dem Bürger durchaus üblich waren. Zugleich zeugte die zitierte Dienstanweisung von der Bereitschaft des seit Januar 1919 amtierenden, sozialdemokratischen Polizeipräsidenten851, solche Verhaltensweisen nicht mehr zu tolerieren und ein grundlegend verändertes, von 849 Vgl. E. Ernst, Eine neue Dienstanweisung für die Berliner Polizei, in: ZDPol, 16. Jg. (1919/20), Nr. 9 (31.7.1919), S. 211. 850 Ernst, Eine neue Dienstanweisung für die Berliner Polizei (31.7.1919), S. 211. 851 Vgl. G. Kotowski, Ernst, Eugen Oswald Gustav, in: Neue Deutsche Biographie, Bd. 4, Berlin 1959, S. 628. IV. Die deutsche Polizei in der Zwischenkriegszeit 208 Freundlichkeit und gegenseitigem Respekt getragenes Verhältnis zwischen Polizei und Bevölkerung herbeizuführen. Auf die Frage, wie dieses Ziel zu erreichen war, ging der bereits weiter oben mehrmals zitierte Breslauer Polizeiinspektor und stellvertretende Vorsitzende der Vereinigung der staatlichen höheren Polizei-Exekutivbeamten Preußens Heinrich Eiben in seinem im Dezember 1919 in der ZD- Pol veröffentlichten Beitrag ein.852 Darin stellte er fest: „Alle Vorwürfe wegen zweckloser Härte und nicht sachdienlichen Vorgehens der Polizei-Exekutivbeamten wie die Klagen wegen mangelnden Verständnisses für die Bedürfnisse des Lebens und die Empfindungen der Menschen gegen sie haben ihre Haupt-, wenn nicht gar ihre einzige Ursache in der ganz unzureichenden Ausbildung und Vorbereitung für den Beruf.“853 Anschließend fuhr er damit fort, auf vier Seiten zu schildern, welche Defizite das damalige polizeiliche Ausbildungswesen aufwies und wie seiner Ansicht nach eine zweckdienliche Ausbildung aussehen sollte. Besonders hervorzuheben ist an dieser Stelle allerdings zunächst die Tatsache, dass er die offensichtlich negative Wahrnehmung des polizeilichen Alltagshandelns durch die Bevölkerung nicht leugnete, sondern als gegeben hinnahm und die Ursachen für dieses gestörte Verhältnis analysierte. Gerade die schonungslose Benennung der von der Bevölkerung beklagten Defizite der Polizei – nämlich ‚zwecklose Härte‘, ‚nicht zweckdienliches Vorgehen‘ und ‚mangelndes Verständnis‘ – ist angesichts der in dieser polizeilichen Fachzeitschrift in jener Zeit üblichen Zurückhaltung bei jeglicher Kritik an Polizeibeamten äußerst bemerkenswert. Dies gilt auch für seine Problemanalyse, die zu dem Ergebnis kam, dass die Schuld für die angeführten Missstände nicht etwa bei der Bevölkerung zu suchen sei, sondern in der Polizei selber, die aufgrund von ungeeigneten Auswahlverfahren und einer viel zu kurzen Ausbildung kaum in der Lage sei, ihren gesetzlichen Auftrag zu erfüllen. Dass eine derart selbstkritische Analyse des Verhaltens der Polizei gegenüber dem Publikum, die bei der aus Polizeibeamten bestehenden Leserschaft dieses Beitrag sicherlich nicht auf ungeteilte Zustimmung gesto- ßen sein dürfte, keinesfalls selbstverständlich war, zeigten die beiden im Folgenden betrachteten Beiträge, die im Frühling 1920 in der ZDPol erschienen. 852 Vgl. H. Eiben, Die Ausbildung der Polizei-Exekutivbeamten, in: ZDPol, 16. Jg. (1919/20), Nr. 19 (18.12.1919), S. 488ff. 853 Eiben, Die Ausbildung der Polizei-Exekutivbeamten (18.12.1919), S. 488. 1. Zusammenbruch und Neuaufbau (1918-23) 209 So begann der am 15. April 1920 vom promovierten Stadtsyndikus und ehemaligen Polizeidirektor Otto Gerland publizierte Beitrag mit dem Titel „Über die Natur der polizeilichen Tätigkeit“ mit der folgenden Feststellung: „Man hört so oft Klagen darüber, daß die Polizeibehörden unter der bisherigen Regierung vor allem ihre Tätigkeit darin gesucht hätten, das Volk zu unterdrücken, mindestens aber durch fortwährendes Eingreifen unaufhörlich zu bevormunden. Demgegenüber wird dann verlangt, daß jetzt die polizeiliche Tätigkeit eine andere werden, sich jetzt nach den Wünschen des Volkes richten, dem Volke freie Bewegung lassen müsse und womöglich gar nicht eingreifen dürfe. Es geben derartige Äußerungen zu Bedenken Anlaß.“854 Der Beitrag ist insbesondere wegen der darin enthaltenen, teilweise paradoxen Argumentation interessant. So begann der Autor seine Ausführungen zunächst mit der Feststellung, dass die Bevölkerung offensichtlich mit dem Auftreten der Polizei im alltäglichen Bürgerkontakt unzufrieden war. Die durchaus folgerichtig erscheinende Forderung, dass sich dies ändern und die Polizei stärker auf die Bedürfnisse der Bürger eingehen müsse, ergänzte er dann allerdings um die sicherlich nicht ernst gemeinte und auf seine aus Polizeibeamten bestehende Leserschaft provokativ wirkende Forderung, dass die Polizei möglicherweise bei Gesetzesverstößen untätig bleiben müsse. Dass Otto Gerland diese unrealistische Forderung in den sich daran anschließenden Ausführungen mit Verweis auf das Allgemeine Preu- ßische Landrecht ablehnte, war daher nicht nur wenig verwunderlich, sondern auch ziemlich müßig. Die von ihm selbst konstatierten, häufigen Beschwerden der Bevölkerung über das Verhalten der Polizei leugnete er nicht, allerdings kam er zu dem Ergebnis, dass diese nicht gerechtfertigt waren, sondern eine unzulässige Verallgemeinerung des Fehlverhaltens von einigen wenigen Beamten darstellten. „Gewiß, irren ist menschlich, und so kann ein Beamter auch einmal in einem einzelnen Falle eine Gefahr als vorhanden ansehen, in dem keine vorliegt. Es kann auch Beamte geben, die dazu neigen, Gefahren zu erblicken. Solche Beamte gab es früher und wird es auch ferner geben. Daß dies aber nicht die Regel ist und auch früher nicht war, […] erhellt aus der bereits vor langen Jahren vom Polizeipräsidium zu Berlin 854 O. Gerland, Über die Natur der polizeilichen Tätigkeit, in: ZDPol, 17. Jg. (1920/21), Nr. 2 (15.4.1920), S. 32. IV. Die deutsche Polizei in der Zwischenkriegszeit 210 erlassenen […] Dienstanweisung für die Schutzmannschaft, in der gesagt wurde: ‚Der Schutzmann hat sich stets klarzumachen, daß er zum Schutze des Publikums gegen die Übertreter der Gesetze oder die Störung der öffentlichen Sitte und Ordnung berufen ist. Er soll seine Tätigkeit nicht durch möglichst viele Anzeigen, sondern dadurch beweisen, daß er das Publikum vor Gesetzesübertretungen warnt und davon zurückhält. Er wird immer richtig handeln, wenn er diesen Grundsatz zur Richtschnur seines Verhaltens macht.‘“855 Interessant war hier vor allem der zweite Satz, der andeutete, dass es auch Polizeibeamte mit einer besonderen ‚Neigung‘ zu Fehlverhalten gab, was seine Leser sicherlich als dezente, aber dennoch deutlich erkennbare Kritik verstehen mussten. Anschließend folgte dann aber eine logisch nicht nachvollziehbare, ziemlich abwegige Begründung, warum solche unerwünschten Verhaltensweisen angeblich „nicht die Regel“ seien: weil es seit „langen Jahren“ eine Dienstanweisung gab, die von Polizeibeamten forderte, den Bürger zu schützen und dabei möglichst präventiv zu handeln. Dass die Existenz einer solchen Dienstanweisung keinesfalls ausschloss, dass Polizeibeamte diese ignorierten, und daher nicht als Beleg dafür dienen konnte, dass die häufigen Beschwerden aus der Bevölkerung unbegründet waren, zog Otto Gerland wohl nicht in Betracht. Den aufmerksamen Lesern dieses Beitrags könnte dieser logische Fehlschluss allerdings durchaus aufgefallen sein. Insgesamt erweckt dieser Beitrag den Eindruck, dass sich der Autor nicht entscheiden konnte, ob er die Polizei für ihre mangelnde Bürgerorientierung kritisieren oder gegen die entsprechende Kritik verteidigen sollte. Im Ergebnis führte diese Ambivalenz zu einer inkonsistenten, widersprüchlichen Argumentation, die zumindest bei Teilen seiner Leserschaft Zweifel an seiner abschließenden Schlussfolgerung geweckt haben dürfte, dass eine grundlegende Verhaltensänderung auf Seiten der Polizei nicht erforderlich sei. Sehr viel deutlicher wurde diesbezüglich ein nur sechs Wochen später – am 27. Mai 1920 – in der gleichen Zeitschrift publizierter Beitrag des Polizeikommissars Karl Rosseburg.856 In diesem stellte er zunächst fest, dass sich die turbulente Anfangsphase der Weimarer Republik nun deutlich beruhigt hätte, so dass es nun an der Zeit sei, 855 Gerland, Über die Natur der polizeilichen Tätigkeit (15.4.1920), S. 32. 856 Vgl. K. Rosseburg, Gemeinnützige Tätigkeit der Polizei im neuen Deutschland und Standeshebung, in: ZDPol, 17. Jg. (1920/21), Nr. 5 (27.5.1920), S. 112ff. 1. Zusammenbruch und Neuaufbau (1918-23) 211 „[…] die Frage zu beleuchten, wie die Polizei sich dem Zeitgeist anpassen und zum Gemeinwohle mitgestaltend wirken kann. […] Es ist ja Tatsache, daß die preußische Polizei ihrer im Straßenleben fühlbaren Härte wegen in manchen Ländern des Erdballes sprichwörtlich geworden ist, und diejenigen, die im Ausland tätig waren, werden mir bestätigen müssen, dass die Glossen hierzu nicht immer zum Vorteile des deutschen Systems ausfielen. Wenn auch nicht verkannt werden darf, daß dieser Polizeigeist im alten Regime viel Gutes gewirkt hat, so ist mit der Revolution doch die Notwendigkeit vor uns hingetreten, diesem Geist der demokratischen Zeit entsprechend einer Umgestaltung zu unterziehen. Die große Strenge der Ordnungs- usw. Polizei, die sehr häufig ins Kleinliche hineingriff, wird dem Bürger zur Last und paßt nicht in die heutige Zeit. Sie löst den Unwillen des Volkes aus und kam dem Staatsganzen nicht förderlich sein.“857 Ganz im Gegensatz zu Otto Gerland ließ Karl Rosseburg keinen Zweifel daran, dass sich das Verhalten der Polizei in der Republik im Vergleich zur Kaiserzeit grundlegend verändern musste. Auch wenn er seine Kritik am Auftreten der früheren Schutzmannschaft, der er vermutlich selbst angehört hatte, gegenüber der Bevölkerung vorsichtig formulierte, stellte er im Laufe seines Beitrags an mehreren Stellen in sehr deutlichen Worten klar, dass das autoritative, distanzierte Verhalten – „die fast sprichwörtlich gewordene Barschheit“858 – der deutschen Polizeibeamten unter den Rahmenbedingungen der Weimarer Republik nicht nur kontraproduktiv, sondern aufgrund der tatsächlichen Machtverhältnisse auch nicht mehr praktizierbar war. Erforderlich sei vielmehr eine Entwicklung hin zu einer bürgerorientierten Polizei, die allen Bevölkerungsschichten gleichermaßen Schutz und Hilfe bot und im alltäglichen Bürgerkontakt zwar bestimmt, aber auch höflich auftrat. Dabei machte er ganz konkrete Vorschläge, wie sich ein Polizeibeamter bei den im Streifendienst typischen Übertretungen verhalten sollte: „M. E. muß sich der Beamte in jedem Einzelfalle zunächst darüber klar werden, ob der böse Wille des Übeltäters vorliegt, oder ob die Tat eine derartige ist, daß sie zweckdienlicherweise im Interesse der Allgemeinheit eine Sühne usw. erfährt. In diesen Fällen ist die Vorlage einer Strafanzeige vonnöten, während im übrigen meistens, je nach Lage der Sache, eine höfliche Belehrung oder einer energische Zurechtweisung 857 Rosseburg, Gemeinnützige Tätigkeit der Polizei (27.5.1920), S. 112. 858 Rosseburg, Gemeinnützige Tätigkeit der Polizei (27.5.1920), S. 113. IV. Die deutsche Polizei in der Zwischenkriegszeit 212 an Ort und Stelle ausreichend und für Polizei und Publikum nutzbringend sein wird.“859 Karl Rosseburg war angesichts der öffentlichen Kritik am Auftreten der Polizei zu der Einsicht gelangt, dass diese im alltäglichen Streifendienst, der in der Regel in der Ahndung von wenig spektakulären Ordnungswidrigkeiten und nur äußerst selten von schweren Gesetzesverstößen bestand, ein zurückhaltendes, deeskalatives Einsatzkonzept verfolgen sollten. Auch wenn der Autor dies nicht explizit anführte, so implizierte dieser Hinweis aber dennoch eine Kritik an der bisherigen Ausübung des polizeilichen Ermessensspielraums, die er wohl für zu streng hielt, was wiederum „dem Bürger zur Last“ wurde und „den Unwillen des Volkes“ auslöste. Ein solcher von „Härte“ und „Strenge“ geprägter „Polizeigeist“ war im Wilhelminischen Deutschland noch möglich und vielleicht sogar angebracht, unter den veränderten Rahmenbedingungen der Republik aber nicht mehr. Dabei betonte der Autor ausdrücklich die Notwendigkeit, „den Zeitgeist jeder Bevölkerungsschicht, namentlich den der arbeitenden Klasse, zu studieren“860, und deutete damit an, dass offensichtlich das Verhalten der Polizei gegenüber gerade diesem Teil der Bevölkerung bisher nicht in der angemessenen Art und Weise stattgefunden hatte. Insofern spiegelte sich hier auch der Grundgedanke des konflikttheoretischen Ansatzes der Polizeisoziologie wider, dass die Polizei kein neutrales Instrument staatlicher Herrschaft, sondern vielmehr ein Mittel der herrschenden Klassen zur Erhaltung ihrer Macht und zur Unterdrückung der Arbeiterklasse bzw. der unteren Gesellschaftsschichten sei.861 Karl Rosseburgs Beitrag verdeutlichte somit, dass es im zweiten Jahr der Weimarer Republik offensichtlich Bestrebungen in der Polizei gab, sich kritisch mit ihrer Rolle in der Gesellschaft und der Art und Weise ihres Auftretens gegenüber dem Bürger auseinanderzusetzen – und zwar sowohl retrospektiv mit Blick auf die Kaiserzeit als auch prospektiv mit Blick auf die neue demokratische Staatsform. Der Autor vermittelte ein durchaus positives Bild von der Republik und ermutigte die Polizeibeamten, sich den neuen Chancen und Risiken zu stellen, da nur auf diese Weise eine Polizei entstehen konnte, die unter den gegebenen Rahmenbedingungen erfolgreich ihre Aufgaben erfüllte und die er explizit als „republikanische Polizei“ bezeichnete: 859 Rosseburg, Gemeinnützige Tätigkeit der Polizei (27.5.1920), S. 113. 860 Rosseburg, Gemeinnützige Tätigkeit der Polizei (27.5.1920), S. 113. 861 Vgl. Reiner, The Politics of the Police, S. 40; Storch, Engels, The plague of blue locusts, S. 61ff. 1. Zusammenbruch und Neuaufbau (1918-23) 213 „Ich bin mir voll bewußt, daß das Werden der republikanischen Polizei noch einen vielseitigen Dornenweg zu gehen hat. Manche Enttäuschung und allerlei Härten wird sie ertragen müssen. Aber je beharrlicher und unbeirrter wir an uns selbst arbeiten, und je eifriger wir unsere Kraft in den Dienst der Wiedergesundung unseres Vaterlandes stellen, desto eher wird der Polizeikörper in die ihm zustehende Position gelangen.“862 Karl Rosseburgs Hinweis auf den „Dornenweg“ und die der Polizei „zustehende Position“ deutete an, dass sein Plädoyer für eine bürgernahe, ‚republikanische‘ Polizei nicht nur das Ergebnis seiner Analyse der polizeilichen Rahmenbedingungen zum damaligen Zeitpunkt war, sondern sicherlich auch mit den – gerade im Vergleich zur Kaiserzeit – unbefriedigenden Arbeitsbedingungen und der geringen gesellschaftlichen Akzeptanz der Polizei in dieser Zeit zusammenhing. Die Bevölkerung hatte die begrenzten Machtmittel und das Versagen der Polizei als Instrument staatlicher Herrschaft in den ersten Monaten nach dem Ende des Ersten Weltkrieges und der Novemberrevolution von 1918 wahrgenommen, was nicht ohne negative Folgen auf die Akzeptanz des staatlichen Gewaltmonopols, das ja nach Albrecht Funk auf der nicht mehr hinterfragten Verinnerlichung der Legitimität der Polizeigewalt basiert863, bleiben konnte. Der Autoritäts- und Legitimitätsverlust, den die Polizei in dieser Zeit erlitt864, war durchaus nachhaltig und erschwerte der Polizei die Bekämpfung der Kriminalität und die Aufrechterhaltung der öffentlichen Ordnung ganz erheblich. Dieser Legitimitätsverlust und seine Auswirkungen auf den Arbeitsalltag der im polizeilichen Streifendienst tätigen Beamten wurden sehr anschaulich in einem ca. ein Jahr später – am 5. März 1921 – von Felix Freudenthal in der ZDPol veröffentlichten Beitrag mit dem Titel „Der Schutz der Polizeibeamten“ beschrieben.865 Darin merkte er an: „Daß die Revolution die staatliche Autorität aufs tiefste erschüttert und in erster Linie das Ansehen und den Respekt vor den Exekutivbeamten in einem großen Teil unseres Volkes untergraben hat, darüber braucht wohl kein Wort weiter verloren zu werden. Von feigen Meu- 862 Rosseburg, Gemeinnützige Tätigkeit der Polizei (27.5.1920), S. 114. 863 Vgl. Funk, Polizei und Rechtsstaat, S. 314 f. 864 Vgl. Buder, Die Reorganisation der preußischen Polizei, S. 20ff.; U. Kluge, Soldatenräte und Revolution – Studien zur Militärpolitik in Deutschland 1918/19, Göttingen 1975, S. 69 f.;. 865 Vgl. F. Freudenthal, Der Schutz der Polizeibeamten, in: ZDPol, 17. Jg. (1920/21), Nr. 25 (5.3.1921), S. 537. IV. Die deutsche Polizei in der Zwischenkriegszeit 214 chelmorden […], begangen gegen die berufenen Hüter der Ordnung, hören wir alle Tage […]. Hat schon in den letzten Jahren des Kaiserlichen Regiments der großstädtische, namentlich der Berliner Janhagel866 die Schutzleute nur zu oft mit Hohn und Spott überschüttet, so glaubt der Mob in den Tagen der Republik, die Freiheit sei dazu da, sich über jedes noch so gerechtfertigte polizeiliche Einschreiten einfach hinwegsetzen und Beamte ohne weiteres niederknallen zu dürfen, die sich ihm bei Begehen strafbarer Handlungen energisch entgegenstellen. Sieht doch der Pöbel, aufgewiegelt von gewissenlosen Hetzern und politischen Agitatoren, in jedem uniformierten Polizisten einen Spitzel, einen Gewaltmenschen, einen Reaktionär, der die Rechte des ‚Volkes‘ zu schmälern und nur die Interessen des ‚Bürgers‘ im vermeintlichen Gegensatz zum Proletariat wahrzunehmen bestrebt ist.“867 Auch wenn die Schilderungen des Autors, dessen berufliche Stellung nicht angegeben wurde, der aber aufgrund seines Doktortitels vermutlich eine hohe hierarchische Position in der Polizei, möglicherweise aber auch in der Justiz oder der Verwaltung, eingenommen haben dürfte, sicherlich überspitzt formuliert waren, so deutete doch gerade seine emotionale, dramatische Ausdrucksweise darauf hin, dass gegen Polizeibeamte gerichtete Gewalt in den ersten Jahren der Republik in der Tat ein weitverbreitetes Phänomen war. Der sich darin ausdrückende Autoritäts- und Legitimitätsverlust der Polizei dürfte sich insofern sehr negativ auf ihre Effektivität bei der Aufrechterhaltung der öffentlichen Ordnung und der Kriminalitätsbekämpfung ausgewirkt haben, als sie auf diesem Gebiet auf die freiwillige Unterstützung der Bevölkerung – beispielsweise bei Fahndungen oder durch Zeugenaussagen – angewiesen war. Nach Ansicht von Felix Freudenthal waren die Polizeibeamten an dieser Konfliktlage aber gänzlich unschuldig. Der Autor ging sogar so weit, dass er die Polizei in eine ‚Opferrolle‘ rückte, während die unteren Bevölkerungsschichten bzw. die Arbeiterklasse seiner Meinung nach als kriminelle, gewalttätige ‚Täter‘ anzusehen sind. Ob seine relativ drastischen Schilderungen, die das Verhalten der Weimarer Polizei in ein positives ‚Licht‘ rückten und in deutlichem Widerspruch zu der weiter oben erörterten Charakterisierung der Polizei dieser 866 ‚Janhagel‘ ist ein veralteter, früher in Norddeutschland üblicher Begriff für ‚Pöbel‘. 867 Freudenthal, Der Schutz der Polizeibeamten (5.3.1921), S. 537. 1. Zusammenbruch und Neuaufbau (1918-23) 215 Jahre als autoritativ und gewalttätig standen868, der Realität entsprachen, ist aber durchaus fraglich. So kritisierte beispielsweise der preußische Innenminister Alexander Dominicus in einem am 5. November 1921 in der ZDPol veröffentlichten, ministeriellen Erlass das Verhalten der für den Streifendienst zuständigen Schutzpolizei gegenüber dem Bürger auf eine Art und Weise, die sich trotz vorsichtiger Wortwahl mit einer ‚Opferrolle‘ der Polizei nicht vereinbaren ließen.869 Dabei stellte er insbesondere fest: „Bei den Verhandlungen im Landtage sowie in der Presse sind verschiedene Vorkommnisse in der Schutzpolizei mitgeteilt worden, die geeignet sind, das Vertrauensverhältnis zwischen ihr und der Bevölkerung zu beeinträchtigen. In zahlreichen Fällen hat die Untersuchung ergeben, daß die Beschuldigungen und Angriffe ungerechtfertigt, übertrieben oder einseitig und tendenziös waren. Es sind aber auch Fälle erwiesen, in denen Beamte ihre Befugnisse überschritten und Übergriffe und Mißhandlungen begangen haben. […] Es liegt im eigenen Interesse der Beamtenschaft, von Persönlichkeiten befreit zu werden, die sich ihrer unwürdig gezeigt haben.“870 Auch wenn der Innenminister hier die Häufigkeit der polizeilichen Übergriffe und Misshandlungen nicht quantifizierte, so ist allein schon aufgrund der Tatsache, dass behördliche Erlasse normalerweise keine Einzelfallregelungen enthalten, sondern generelle Regeln für wiederkehrende, gleichartige Tatbestände aufstellen, zu vermuten, dass polizeiliches Fehlverhalten gegenüber der Bevölkerung häufig vorkam. Weitere Zweifel an Felix Freudenthals Ausführungen, in denen die Polizei als ‚Opfer‘ des gewalttätigen ‚Pöbels‘ dargestellt wurde, ergaben sich aber auch aus der Wortwahl und dem emotional geladenen Sprachstil des Autors, die auf eine rechte, sehr konservative politische Gesinnung hindeuteten. Sehr deutlich wurde dies vor allem in Felix Freudenthals Analyse der Ursachen für diese unbefriedigenden Zustände sowie in seinen Handlungsempfehlungen zu ihrer Verbesserung. „Geradezu unheilvoll hat der lange Krieg und die ihm folgenden Umsturzbestrebungen auf einen Teil unserer in zuchtloser Ungebunden- 868 Vgl. auch Hartewig, »Eine sogenannte Neutralität der Beamten gibt es nicht«, S. 315ff. 869 Vgl. A. Dominicus, Verhalten der Beamten der Schutzpolizei, in: ZDPol, 18. Jg. (1921/22), Nr. 15 (5.11.1921), S. 330. 870 Dominicus, Verhalten der Beamten der Schutzpolizei (5.11.1921), S. 330. IV. Die deutsche Polizei in der Zwischenkriegszeit 216 heit heranwachsenden Jugend gewirkt, der Gottesfurcht, Moralität, Arbeitslust und Pietät nur noch lächerliche und überwundene Begriffe zu sein scheinen, mit denen je eher je lieber aufzuräumen ein hervorragendes Verdienst ist. Die äußerst betrübenden Zustände werden sich bei den tiefklaffenden und kaum überbrückbaren Gegensätzen zwischen den einzelnen Bevölkerungsklassen in Zukunft nur noch verschärfen, wenn nicht eine energische Regierung mit eiserner Hand hierin Wandel schafft und die Gerichte gegen böswillige Übeltäter, denen die Strafgesetze mehr als gleichgültig sind, keinerlei Nachsicht üben.“871 Felix Freudenthals Bezeichnung der Novemberrevolution von 1918 als „Umsturzbestrebungen“, seine Einschätzung, dass die Klassengegensätze in der Weimarer Gesellschaft eher zu- als abnehmen wurden, und sein Eintreten für eine „energische Regierung mit eiserner Hand“ lassen vermuten, dass der Autor der Republik und ihrer Regierung äußerst kritisch gegen- überstand und damit einen Teil der Polizei vertrat bzw. mit seinem Beitrag ansprach, der konservativ-reaktionär geprägt war und dementsprechend im Rahmen der in den Anfangsjahren der Weimarer Republik durchaus häufig stattgefundenen Konflikte zwischen Polizei und Arbeiterschaft tendenziell gewaltsame Konfliktlösungen gegenüber deeskalativen Einsatzkonzepten bevorzugt haben dürfte. Felix Freudenthal stand damit für ein Polizeiverständnis, das sich nur schwer in Einklang bringen ließ mit der in den oben dargestellten Beiträgen von republikfreundlichen Autoren wie Karl Rosseburg oder – weiter oben872 – Heinrich Eiben geforderten Errichtung einer demilitarisierten, bürgernahen, allen Bevölkerungsschichten gleichermaßen dienenden Polizei als wichtigster Stütze der demokratisch gewählten Regierung. Belastbare Aussagen über die relative Bedeutung dieser ‚Strömungen‘ innerhalb wie außerhalb der Polizei lassen sich auf der Grundlage der betrachteten Beiträge in der ZDPol nicht machen, allerdings lässt die emotionale Ausdrucksweise in den Ausführungen von Felix Freudenthal ein erhebliches Maß an Verbitterung oder sogar Verzweiflung über den Autoritätsverlust der Polizei erkennen, was darauf hindeutete, dass sein konservatives Polizeibild in den Anfangsjahren der Weimarer Republik zumindest außerhalb der Polizei auf wenig Akzeptanz stieß. „Wo soll da unseren Polizeibeamten, die gegen das Gesindel ihre Haut zu Markte tragen müssen, die ernste Berufsfreudigkeit und der uner- 871 Freudenthal, Der Schutz der Polizeibeamten (5.3.1921), S. 537. 872 Vgl. z. B. Eiben, Die Polizei der Demokratie (24.4.1919), S. 9ff. 1. Zusammenbruch und Neuaufbau (1918-23) 217 läßliche Betätigungsdrang herkommen, um mit voller Energie gegen Exzesse einzuschreiten, Diebes- und Räuberbanden nachzuspüren und auch sonst den Schutz des Publikums, das so oft gegen sie Partei ergreift, wirksam durchzuführen!“873 Eine wohl realistischere Einschätzung der Ursachen für den mangelnden Rückhalt der damaligen Polizei in der Bevölkerung gab der Breslauer Polizeihauptmann Simon in seinem im Juni 1923 in der ZDPol publizierten Beitrag, der sich mit dem Aufbau und den Funktionen der damals zu ‚Einheitsrevieren‘ reorganisierten Polizeireviere in Preußen beschäftigte.874 Hier stellte er fest: „Wenn auch anerkannt werden muß, daß bei den unsicheren politischen Verhältnissen innerhalb und außerhalb des Deutschen Reiches […] eine starke, schlagkräftige Polizei, die auch als Kampftruppe zum Kampf gegen bewaffnete Banden geeignet ist, unbedingt notwendig war und auch weiterhin notwendig bleiben wird, so hätte doch den Aufgaben, die die Polizei auf allgemeinem polizeilichem Gebiet zu erledigen hat, auch mehr Wert beigelegt werden müssen. Es genügt nicht, daß wir eine gut vorbereitete Polizei nur für besondere, etwa in Erscheinung tretende Vorkommnisse haben, sondern eine allgemeine vorbeugende Polizei, die auch den Ansprüchen des Publikums in normalen Zeiten gerecht werden kann, ist nicht zu entbehren.“875 Nach Ansicht des Autors war die Schuld für das schlechte Verhältnis zwischen Polizei und Bevölkerung sehr wohl in der Polizei bzw. in ihrer Organisation zu sehen. So hätte die in den ersten Nachkriegsjahren politisch vorgegebene Fokussierung auf den Aufbau von schlagkräftigen geschlossenen Schutzpolizeieinheiten, die zur Niederschlagung von Unruhen und Aufständen eingesetzt werden konnten, zugleich zu einer Vernachlässigung des polizeilichen Streifendienstes geführt. Gerade dieser sei aber besonders wichtig, um „den Ansprüchen des Publikums […] gerecht zu werden“, so dass es nicht weiter verwunderlich sei, wenn sich die Akzeptanz der Polizei in der Bevölkerung in dieser Zeit verschlechterte. Um dieses Defizit zu beheben, sei es dementsprechend erforderlich, ein ausgewogeneres Verhältnis zwischen diesen beiden gleichermaßen wichtigen Funktionen der Polizei zu finden. Dabei zeigte sich der Autor davon überzeugt, 873 Freudenthal, Der Schutz der Polizeibeamten (5.3.1921), S. 537. 874 Vgl. Simon, (Vorname fehlt), Aufbau und Tätigkeit der Einheitsreviere der staatlichen Polizei, in: ZDPol, 20. Jg. (1923/24), Nr. 5 (5.6.1923), S. 68ff. 875 Simon, Aufbau und Tätigkeit der Einheitsreviere (5.6.1923), S. 68. IV. Die deutsche Polizei in der Zwischenkriegszeit 218 dass dieses Ziel durch die beschlossene Bildung von Einheitsrevieren erreicht werden würde, so dass sich im Anschluss an die Reorganisation eine Verbesserung der Beziehungen zwischen Polizei und Publikum ergeben sollte. Dass die Erreichung dieses Ziels aber zumindest kurzfristig nicht erreicht wurde, zeigte der etwa sechs Monate später – am 5. Januar 1924 – in der ZDPol veröffentlichte Beitrag des Berliner Kriminalkommissars Ernst Engelbrecht mit dem Titel „Polizei und Publikum“.876 Dieser beschäftigte sich explizit mit der Notwendigkeit der Zusammenarbeit der Polizei mit der Bevölkerung und merkte dabei an: „Weit erfolgreicher könnte sich die Arbeit der Polizei gestalten, wenn die Polizei einer verständigen Mitarbeit des Publikums sicher sein könnte. Aber gerade hier liegt so vieles im Argen. Nur selten findet die Polizei bei ihrer Arbeit eine wirklich ausreichende Unterstützung durch das Publikum. Meistens zeigt das Publikum eine große Scheu vor der Polizei und hält mit seinem Angaben und Aussagen sehr zurück. […] Es fehlt eben das wirkliche Interesse, man ist zu bequem und fürchtet die Rache des Verbrechers oder die ‚Lauferei‘ zur Polizei. […] Ganz besonders zeigt sich dieser Mangel an Hilfsbereitschaft den Polizeibeamten persönlich gegenüber. Ersuchen von Polizeibeamten um Hilfeleistung wird nicht nachgekommen, selbst kleinste, aber notwendige Hilfeleistungen […] werden abgelehnt oder nur widerwillig ausgeführt. […] Häufig kann man in den Tageszeitungen lesen, daß bei der Festnahme irgendeines Verbrechers das Publikum Partei für diesen und gegen den Polizeibeamten genommen, ja den Beamten direkt angegriffen hat. Alles dies ist natürlich nicht geeignet, die Arbeit des Polizeibeamten zu fördern, der statt Unterstützung seitens des Publikums nur brüske Abweisung findet.“877 Ernst Engelbrechts Ausführungen ließen keinen Zweifel daran, dass die Beziehungen zwischen der Polizei und der Bevölkerung seiner Einschätzung nach zu Beginn des Jahres 1924 katastrophal waren. Bemerkenswert war insbesondere der Hinweis auf gegen Polizeibeamten gerichtete physische Gewalt durch die Bevölkerung, die wohl nicht nur in Einzelfällen, sondern sogar „häufig“ stattfand, und die weit über einen Mangel an Akzeptanz hinaus ging und vielmehr auf eine äußerst feindselige Haltung 876 Vgl. E. Engelbrecht, Polizei und Publikum, in: ZDPol, 20. Jg. (1923/24), Nr. 19 (5.1.1924), S. 321 f. 877 Engelbrecht, Polizei und Publikum (5.1.1924), S. 321. 1. Zusammenbruch und Neuaufbau (1918-23) 219 hindeutete. Zugleich war der Autor davon überzeugt, dass die Polizeibeamten an dieser Konfliktlage gänzlich unschuldig waren. Seine Argumente wirkten dabei nicht nur ziemlich naiv, sondern waren auch in sich widersprüchlich. So führte er die mangelnde Bereitschaft zur Zusammenarbeit u. a. auf die Faulheit und Bequemlichkeit der Bevölkerung zurück, was aber angesichts der ebenfalls von ihm beklagten Angriffe auf Polizeibeamte wenig überzeugend war. Einen Hinweis darauf, dass die mangelnde Unterstützung der Polizei durch die Bevölkerung möglicherweise etwas mit der Art und Weise zu tun haben könnte, wie die Polizei ihre Arbeit machte und wie sie dabei den Bürger behandelte, suchte man in seinem Beitrag vergebens. Zusammenfassend lässt sich folglich festhalten, dass die Polizei in den Anfangsjahren der Weimarer Republik bei der Erfüllung einer ihrer wichtigsten Aufgaben – nämlich den polizeilichen Streifendienst – enorme Schwierigkeiten hatte, die im Wesentlichen auf drei Faktoren zurückzuführen waren: (1) den sehr nachhaltigen Autoritäts- und Legitimitätsverlust, den sie im Zuge ihres Zusammenbruchs im Rahmen der Novemberrevolution von 1918 erlitten hatte, (2) die im Vergleich zum Kaiserreich veränderten gesellschaftlichen Erwartungen in Bezug auf das Verhalten der Polizei gegenüber der Bevölkerung und (3) die politisch vorgegebene Fokussierung auf den Aufbau von schlagkräftigen geschlossenen Schutzpolizeieinheiten, die zwangsläufig zu Lasten des normalen Streifendienstes gehen musste. Diese Faktoren hatten zur Folge, dass weite Teilen der Bevölkerung der Polizei sehr kritisch gegenüber standen, sie nicht unterstützten und sie auch nicht als legitimen Vertreter ihrer Interessen akzeptierten. Auf Seiten der Polizei hatte dies eine enorme Verunsicherung zur Folge, die bei einem Teil der Polizeibeamten sicherlich den Wunsch nach einer Wiederherstellung der vorrevolutionären Verhältnisse weckte, die bei einem anderen Teil aber auch zu Selbstkritik und der Einsicht führte, dass sie sich unter den neuen Rahmenbedingungen zu einer bürgernahen, demokratischen Werten verpflichteten, ‚republikanischen‘ Polizei weiterentwickeln mussten. Gleichwohl muss man für die Anfangsjahre der Weimarer Republik konstatieren, dass der bei der Analyse des polizeilichen Alltaghandelns deutlich werdende, geringe Rückhalt der Polizei in der Bevölkerung, der teilweise sogar in eine feindseligen Haltung überging, die ihr zugedachte Funktion als Instrument staatlicher Herrschaft sicherlich einschränkte. IV. Die deutsche Polizei in der Zwischenkriegszeit 220 Kriminalpolizei in der Krise Das zweite zentrale Aufgabenfeld der Polizei neben dem polizeilichen Streifendienst war in der Weimarer Zeit und ist auch heute noch der Kriminal- und Ermittlungsdienst. Dieser umfasst die auf die Verhütung und Verfolgung von Straftaten abzielenden kriminalpolizeilichen Tätigkeiten (‚criminal investigation‘) und wird in der Regel nicht von uniformierten Schutzpolizisten, sondern von nicht-uniformierten Kriminalbeamten ausgeübt.878 Insofern ist das entscheidende Abgrenzungsmerkmal darin zu sehen, dass die entsprechenden Tätigkeiten von Polizeibeamten ausgeübt werden, die sich ausschließlich der Verbrechensbekämpfung widmen.879 Im Kern geht es beim Kriminal- und Ermittlungsdienst darum, Straftäter bzw. Verdächtige zu ermitteln und Beweise für deren Schuld oder Unschuld zu sammeln, die anschließend der Staatsanwaltschaft bzw. den Gerichten übergeben werden. Kriminalpolizeiliche Tätigkeiten können sich auf sehr unterschiedliche Straftaten erstrecken, insbesondere Tötungs-, Sexual-, Eigentums-, Staatsschutz- und Wirtschaftsdelikte sowie organisierte Kriminalität, und erfordern daher teilweise ein hohes Maß an kriminalistischem Fachwissen (z. B. im Bereich Spurensicherung), das nur von entsprechend spezialisierten Beamten vorgehalten wird.880 Diese im Vergleich zur Schutzpolizei stärkere Spezialisierung der Kriminalbeamten ist sicherlich einer der Gründe dafür, dass diese Tätigkeit als „probably the most glamorous one in the police department“ gilt und Kriminalbeamte von ihren Kollegen im schutzpolizeilichen Bereich oftmals beneidet werden.881 Auch wenn diese zum Teil auch von den Medien betriebene ‚Glorifizierung‘ des kriminalpolizeilichen Ermittlers in der polizeiwissenschaftlichen Literatur e) 878 Vgl. Bayley, What do the police do? S. 144ff.; M. Maguire, Criminal investigation and crime control, in: T. Newburn [Hrsg.], Handbook of Policing, 2. Aufl., Cullompton u. a. 2008, S. 431ff.; Thibault, Lynch, McBride, Proactive Police Management, S. 180ff.; Wilz, Die Polizei als Organisation, S. 120. 879 Vgl. M. Teufel, Vom Werden der deutschen Kriminalpolizei, in: P. Nitschke [Hrsg.], Die deutsche Polizei und ihre Geschichte – Beiträge zu einem distanzierten Verhältnis, Hilden 1996, S. 76. 880 Vgl. Maguire, Criminal investigation and crime control, S. 439ff.; C. Alkaya, A. Vera, Generalisierung oder Spezialisierung? Eine vergleichende Betrachtung der kriminalpolizeilichen Sofortbearbeitung in Berlin München und Hamburg, in: R. Ritsert, A. Vera [Hrsg.], Von Streifenpolizisten, Spezialisten und Führungskräften: ausgewählte empirische Studien zur Optimierung der Polizeiarbeit, Frankfurt a. M. 2013, S. 18ff. 881 Vgl. Thibault, Lynch, McBride, Proactive Police Management, S. 162, S. 180 f. (Zitat: S. 180). 1. Zusammenbruch und Neuaufbau (1918-23) 221 relativiert und größtenteils als Mythos entlarvt worden ist, so gilt der Kriminal- und Ermittlungsdienst weiterhin als „the epitome of policing“.882 Dass dies wohl auch schon in der Weimarer Zeit galt, soll die folgende Passage aus einem von Albrecht Böhme, dem damaligen Stellvertreter des Präsidenten des Sächsischen Landeskriminalamts, im Februar 1925 in der ZD- Pol veröffentlichten Beitrag anekdotisch veranschaulichen: „Mit dem Begriff der Kriminalpolizei hat man sich bisher wohl überhaupt noch nicht näher beschäftigt. Ihn wissenschaftlich einwandfrei festzulegen, ist nicht möglich. […] Ich möchte die Kriminalpolizei als den Teil der Polizei bezeichnen, dem die Aufgabe zufällt, die schwierigsten polizeilichen Aufgaben zu lösen. Von diesem Gesichtspunkte aus gehört zum Aufgabenkreis der Kriminalpolizei die Beobachtung und Bekämpfung aller Verbrechenserscheinungen, die für den inneren und äußeren Bestand des Staates von Wichtigkeit sind […].“883 Interessant an dieser Passage war aber nicht nur die vom Autor vertretene Ansicht, dass die Kriminalpolizei vor allem die ‚schwierigsten‘ und ‚wichtigsten‘ polizeilichen Aufgaben erledigte, sondern darüber hinaus auch seine Einschätzung, dass er wohl der erste Mensch sei, der sich mit der Abgrenzung des Begriffs der Kriminalpolizei beschäftigte. Auch wenn diese Einschätzung mehr als fragwürdig war, so deutete sie aber darauf hin, dass die Kriminalpolizei im Jahr 1925 in der Tat noch ein relativ junger Zweig innerhalb der Polizei war. So existierten damals organisatorisch eigenständige Kriminalpolizeiabteilungen bzw. Polizeibehörden mit einer nennenswerten Anzahl an Kriminalpolizeibeamten nur in größeren Städten. Berlin, das seit 1830 über eine Kriminalpolizeiabteilung verfügte, spielte in diesem Aufgabenfeld nicht nur eine Vorreiterrolle, sondern verfügte auch – wie Abbildung 12 veranschaulicht – mit mehr als 450 Kriminalbeamten zu Beginn des 20. Jahrhunderts und mehr als 2.200 Kriminalbeamten im Jahr 1931 mit viel Abstand über den größten Personalkörper in diesem Bereich.884 Außerhalb der Großstädte waren die Personalressourcen so knapp, dass die kriminalpolizeilichen Aufgaben von Schutzpolizeibeamten erle- 882 Vgl. Maguire, Criminal investigation and crime control, S. 434ff.; Bayley, What do the police do? S. 145 f. (Zitat: S. 146). 883 A. Böhme, Kriminalpolizeiliche Organisationsformen, in ZDPol, 21. Jg. (1924/25), Nr. 21 (5.2.1925), S. 546. 884 Vgl. Wagner, Volksgemeinschaft ohne Verbrecher, S. 79ff.; B. Weiß, 25 Jahre Kriminalpolizei, in: ZDPol, 25. Jg. (1928), Nr. 7 (10.4.1928), S. 210. Die zweitgrößte Kriminalpolizeibehörde im Jahr 1931war diejenige Hamburgs mit etwas mehr als 500 Beamten. IV. Die deutsche Polizei in der Zwischenkriegszeit 222 digt wurden. Die geringe Zahl an Kriminalbeamten war sicherlich auch einer der Gründe, warum man in den ersten Jahren der Weimarer Republik kaum Publikationen in der ZDPol finden konnte, die sich mit kriminalpolizeilichen Themen beschäftigten. Personalstärke der Berliner Kriminalpolizei Der andere wichtige Grund war vermutlich die allgemeine Kriminalitätslage in den turbulenten Anfangsjahren der Weimarer Republik, die geprägt war durch ein hohes Maß an politischer Gewalt in Form von Unruhen und Aufständen, aber auch durch Hungerkrawalle und Plünderungen sowie durch Straßen- und Alltagskriminalität, insbesondere in Form von Diebstahldelikten, die aus der wirtschaftlichen Not breiter Bevölkerungsschichten resultierten.885 Unter solchen Bedingungen waren breit einsetzbare Schutzpolizeibeamte, ob nun in geschlossenen Einheiten oder als Streifenbeamte, kurzfristig sicherlich nützlicher als spezialisierte Kriminalbeamte, so dass die politischen Entscheidungsträger beim Aufbau der Polizei nach dem Weltkrieg verständlicherweise zunächst den schutzpolizeilichen Bereich priorisierten. Darauf deutete auch ein im Juli 1919 in der ZDPol ver- öffentlichter Beitrag hin, der relativ ausführlich in zwei Teilen die Inhalte von mehreren, in den beiden Vormonaten stattgefundenen Sitzungen des Abb. 12: 885 Vgl. Wagner, Volksgemeinschaft ohne Verbrecher, S. 30ff.; Bessel, Militarisierung und Modernisierung, S. 331ff. Vgl. auch Abbildung 6 weiter oben. 1. Zusammenbruch und Neuaufbau (1918-23) 223 Staatshaushaltsausschusses wiedergab, die sich mit der inneren Sicherheit im Deutschen Reich beschäftigt hatten.886 In Bezug auf damalige Kriminalitätslage bestätigte der Reichsinnenminister Hugo Preuß zunächst den oben beschriebenen, aus der ökonomischen Krise in den ersten Nachkriegsjahren und der allgemeinen Not in der Bevölkerung resultierenden Anstieg der Diebstahlkriminalität: „Der Minister des Innern hob hervor, die Zunahme der Kriminalität sei die Folge des vierjährigen Krieges und des Hungerzustandes. Der Krieg habe die Leute verroht und sie an gesetzwidriges Eingreifen in fremdes Eigentum gewöhnt.“887 Diesen unbefriedigenden Zustand wollte der Innenminister nicht akzeptieren. Daher stellte er einige Maßnahmen vor, die er zu ergreifen beabsichtigte und von denen er sich einen Rückgang der Kriminalität erhoffte: „Auf dem Lande brauche man eine vermehrte Gendarmerie und für die Städte andere Schutzmannschaften als die bisherigen. Man brauche auch in einer Großstadt wie Berlin gegenüber dem Verbrechertum schlagfertige jüngere Leute, denen man mehr zumuten könne als den in Ehren grau gewordenen verheirateten, mit Kindern gesegneten Schutzleuten. So wolle er für Berlin die Schutzmannschaft durch Aufnahme jüngerer Unteroffiziere schlagfertiger gestalten. Außerdem müsse er daran denken, die Gendarmerie auf dem Lande zu verstärken. Wieweit man darin gehen könne, lasse sich gegenwärtig noch nicht ermessen.“888 Die Kriminalpolizei wurde nicht einmal erwähnt, was darauf schließen ließ, dass sie in seinen Überlegungen keine Rolle spielte. Auffällig war zudem die zweimalige Verwendung der Adjektive ‚jünger‘ und ‚schlagfertig‘ in Bezug auf die neu einzustellenden Polizeibeamten, die ein Idealprofil des benötigten Polizeibeamten zeichnete, das überhaupt nicht demjenigen des in der Regel gut ausgebildeten, erfahrenen, lebensälteren und daher auch nicht mehr besonders ‚schlagfertigen‘ Kriminalbeamten entsprach. Insofern bestätigte die Einschätzung des Innenministers die oben dargestellte Problemanalyse: Die Sicherheitslage im Deutschland Mitte des Jahres 1919 erforderte vor allem junge, gesunde, körperlich leistungsfähige 886 Vgl. o. V., Die öffentliche Sicherheit im Staatshaushaltsausschuß, in: ZDPol, 16. Jg. (1919/20), Nr. 8 (17.7.1919), S. 180ff., Nr. 9 (31.7.1919), S. 209ff. 887 o. V., Die öffentliche Sicherheit im Staatshaushaltsausschuß (31.7.1919), S. 181. 888 o. V., Die öffentliche Sicherheit im Staatshaushaltsausschuß (31.7.1919), S. 181. IV. Die deutsche Polizei in der Zwischenkriegszeit 224 Streifenbeamte und Bereitschaftspolizisten, die unmittelbar ‚auf der Stra- ße‘ gegen die galoppierende Alltagskriminalität und bei politischen Unruhen eingesetzt werden konnten. Die Aufstockung der Kriminalpolizei war unter diesen Bedingungen zweitrangig. Hinzu kam, dass der Kriminalpolizei zum damaligen Zeitpunkt wohl nicht nur eine vergleichsweise geringe Priorität von Seiten der politischen Führung beigemessen wurde, sondern sie auch Gegenstand von öffentlicher Kritik war: „Weiter richtete er [ein Ausschussmitglied] die Aufmerksamkeit des Ministers auf die Spezialdezernate, die in großen Städten zur Bekämpfung gewisser Verbrecherspezialitäten vorhanden seien. Er glaube, diese Spezialisierung gehe teilweise zu weit. Vor kurzer Zeit sei in Berlin ein Spezialdezernat für die Bekämpfung des Handels mit ausländischer Valuta errichtet worden. Dabei habe es sich herausgebildet, daß Beamte dieser Spezialdezernate mit diesen Valutahändlern gemeinsame Sache gemacht hätten. Ähnliche Verhältnisse hätten sich auch in anderen Spezialdezernaten herausgebildet.“889 Auch wenn die Erwiderung des Innenministers auf diesen Redebeitrag im Beitrag nicht enthalten war, so deutete diese Passage darauf hin, dass die Kriminalpolizei im Jahr 1919 keine besonders hohe Wertschätzung genoss. Nicht nur, dass das Ausschussmitglied die weitgehende Spezialisierung der Kriminalpolizei, die ein elementares Wesensmerkmal dieses Tätigkeitsfeldes war und weiterhin ist, kritisierte, sondern sie sah sich zudem offensichtlich auch mit durchaus gravierenden Korruptionsvorwürfen konfrontiert. Ob diese Vorwürfe gerechtfertigt waren, lässt sich nicht eindeutig klären, allerdings sprach ihre relativ genaue Spezifizierung (‚Handel mit ausländischer Valuta‘) durch das Ausschussmitglied dafür, dass diese durchaus fundiert waren. Gerade in Bezug auf Kriminalbeamte, die eigentlich für die Aufklärung solcher Delikte zuständig waren, stellte schon der Verdacht auf Korruption ein verheerendes Signal dar, das auf eine desolate Arbeitssituation und -moral sowie im Zusammenspiel mit der oben festgestellten Priorität von schutzpolizeilichen Aspekten auf eine massive Krise der Kriminalpolizei in diesen ersten Monaten der Weimarer Republik hindeutete. Der nächste in der ZDPol publizierte Beitrag, der sich explizit mit der Kriminalpolizei auseinandersetzte, erschien wenige Monate später, im Oktober 1919, und bestand aus der wörtlichen Wiedergabe eines Beitrags des promovierten Amtsrichters Albert Hellwig, den dieser zuvor in der Vossi- 889 o. V., Die öffentliche Sicherheit im Staatshaushaltsausschuß (31.7.1919), S. 181. 1. Zusammenbruch und Neuaufbau (1918-23) 225 schen Zeitung veröffentlicht hatte.890 In diesem hatte er im Allgemeinen die Verstaatlichung, Zentralisierung und Spezialisierung der Kriminalpolizei und im Besonderen die Einrichtung einer deutschlandweit agierenden, mobilen Reichs-Kriminalpolizei nach dem Vorbild der in Frankreich seit 1907 existierenden „fliegenden Brigaden“ gefordert. Als Begründung hierfür führte er Folgendes an: „Verstaatlicht muß die Kriminalpolizei, die in den meisten Städten und auf dem Lande noch zur Kommunalpolizei gehört, werden, da das schwere Verbrechertum, insbesondere das berufsmäßige, nicht an bestimmte Orte gebunden ist. Aus der Beweglichkeit des modernen Verbrechertums, das den Schauplatz seiner Tätigkeit schnell zu wechseln liebt, folgt ferner, daß die Kriminalpolizei so organisiert werden muß, daß sie schnell dem Verbrecher zu folgen vermag.“891 Der Autor verwies hier auf das Auftauchen einer neuartigen, „modernen“ Form der Kriminalität, die sich durch eine besonders hohe Mobilität auszeichnete und die er dem „schwere[n]“, „berufsmäßige[n]“ oder „gewerbsmäßige[n]“ Verbrechertum zurechnete. Diese Form von Kriminalität lasse sich mit der bisherigen, lokal auf der kommunalen Ebene verankerten Form kriminalpolizeilichen Arbeitens nicht mehr erfolgreich bekämpfen, so dass die Einrichtung von überregional agierenden Kriminalpolizeibehörden geboten sei. Dabei war er sich offensichtlich im Klaren darüber, dass die Einrichtung einer einheitlichen Reichs-Kriminalpolizei kurzfristig nicht zu realisieren war, so dass er als Zwischenlösung vorschlug, „zunächst Landes-Kriminalpolizeibehörden nach dem Muster der Sächsischen Landes-Kriminalpolizei zu bilden“892. Interessant war hier aber vor allem sein Verweis auf das seiner Einschätzung nach besonders gefährliche, „berufsmäßige Verbrechertum“, das aufgrund der gestiegenen Mobilität weiter an Gefährlichkeit gewonnen habe und daher zu einer noch größeren Bedrohung für die innere Sicherheit geworden sei, die in den Zuständigkeitsbereich der Kriminalpolizei fiel und ihre umfassende, grundlegende Neuausrichtung erforderte. Angesichts der oben angesprochenen, allgemeinen Krise der Kriminalpolizei in den ersten Monaten und Jahren der Weimarer Republik, lag es auf der Hand, dass man diese in einen Zusammenhang mit dem ‚gewerbs- 890 Vgl. A. Hellwig, Reichs-Kriminalpolizei, in: ZDPol, 16. Jg. (1919/20), Nr. 14 (9.10.1919), S. 343. 891 Hellwig, Reichs-Kriminalpolizei (9.10.1919), S. 343. 892 Hellwig, Reichs-Kriminalpolizei (9.10.1919), S. 343. IV. Die deutsche Polizei in der Zwischenkriegszeit 226 mäßigen Verbrechertum‘ stellen konnte. Dieser wurde dann in einem wenige Monate später, im Januar 1920, in der ZDPol publizierten Beitrag, bei dem zwar auf die Angabe des Autorennamens verzichtet wurde, bei dem aber die Vermutung nahe liegt, dass es sich um einen in Berlin tätigen, leitenden Kriminalbeamten gehandelt haben dürfte, sehr plakativ deutlich gemacht. Dies zeigten schon die im Folgenden wiedergegebenen, ersten beiden Sätze des Beitrags: „Wieder ist ein Kriminalbeamter in seinem Dienst, im Dienst für den Staat, für die Allgemeinheit, ermordet worden. Wie der Soldat im Felde, hat der ermordete Kriminal-Bezirksoberwachtmeister Erdmann in Berlin sein Leben in der Bekämpfung des gewerbsmäßigen Verbrechertums hergeben müssen.“893 Wie unschwer zu erkennen ist, zielte der Autor hier nicht auf eine sachliche Auseinandersetzung mit einem Polizeieinsatz oder einem anderen fachlichen Problem, sondern auf eine emotionale Beeinflussung seiner Leserschaft ab. Dies sollte erreicht werden, indem, ein starker Kontrast hergestellt wurde zwischen den bösen, mordenden „gewerbsmäßigen“ Verbrechern und den guten Kriminalbeamten, die ‚wie Soldaten‘ ihr Leben heldenhaft opferten, um den Staat und seine Bürger zu schützen. Die bei der aus Polizei- und damit auch Kriminalbeamten bestehenden Leserschaft dieses Beitrags auf diese Weise bewirkte Empörung sollte im weiteren Verlauf noch weiter gesteigert werden, indem nicht nur die „verabscheuungswürdige Tat“ der zwischenzeitlich wohl gefassten, mehrfach vorbestraften Täter sehr anschaulich dargestellt („mit etwa 30 Schüssen niedergestreckt“), sondern auch auf die in den Jahren zuvor „gegen sie oft zu milde erkannten Strafen“ verwiesen wurde. Letzterer Aspekt wurde anschließend noch weiter vertieft, indem ausgeführt wurde: „Wie jedem praktisch tätigen Kriminalbeamten bekannt ist, hat das gewerbsmäßige Verbrechertum dafür ein sehr feines Gefühl, in welcher Weise sie von den verschiedenen Gerichten angefaßt werden. Den Groß-Berliner Verbrechern ist es bekannt, daß gerade von den Berliner Gerichten ganz bedeutend mildere Strafen verhängt werden als von Provinzgerichten. […] In dieser Tatsache ist mit ein Grund zu suchen, daß das Verbrechertum besonders in Berlin so unheimlich angeschwollen ist und sich, wenn nicht bald die Praxis der Berliner Gerichte dem 893 o. V., Die Polizei im Kampf mit dem Verbrechertum, in: ZDPol, 16. Jg. (1919/20), Nr. 21 (15.1.1920), S. 529. 1. Zusammenbruch und Neuaufbau (1918-23) 227 gewerbsmäßigen Verbrechertum gegenüber eine andere wird, zu einer riesengroßen Gefahr für den Staat und seine Bevölkerung auswächst.“894 Der namentlich nicht genannte Autor stellte hier also sehr deutlich heraus, dass die zu milde Bestrafung von gefassten Verbrechern seiner Einschätzung nach eine wesentliche Ursache für den Anstieg der Kriminalität in den letzten Jahren gewesen war. Diese Kritik bezog sich zum einen unmittelbar auf die Berliner Gerichte bzw. die dort tätigen Richter, mittelbar dürfte er damit aber auch die gesetzlichen Regelungen, die die Grundlage für die Rechtsprechung und damit auch für die milden Urteile der Berliner Richter bildeten, gemeint haben, so dass auch die Regierung und das Parlament Gegenstand seiner Kritik waren. Die Kriminalpolizei „habe unter schwierigsten Bedingungen ihre Pflicht getan“895 und ihre Aufgaben erledigt, indem sie zahlreiche ‚Berufsverbrecher‘ fasste, allerdings wurde diese Bemühungen anschließend durch zu milde Urteile wieder zunichte gemacht. Im Ergebnis zeichnete er auf diese Weise ein Bild des Kriminalbeamten, der sich für den Staat aufopferte, der aber von diesem im Stich gelassen wurde, und unterstrich so die oben konstatierte Krise der Kriminalpolizei zu Beginn der Weimarer Republik. Die schwierige Situation der Kriminalpolizei sprach der Autor sogar explizit an: „Man begegnet nun nach dem Vorfall oftmals einer Kritik über die Tätigkeit der beteiligten Beamten. Leicht ist es, an der Tätigkeit von Polizeibeamten und insbesondere von Kriminalbeamten Kritik zu üben, und diese Kritik wird selten dem Beamten wohlwollend sein, wenn dem Beamten ein Erfolg nicht beschieden war.“896 Auch wenn der Autor im Folgenden nicht weiter auf diese öffentliche Kritik an der Kriminalpolizei einging, so verdeutlichten doch die Hinweise auf den mangelnden Erfolg manch eines kriminalpolizeilichen Einsatzes sowie auf die „oftmals“ geäußerte Kritik, dass die Berliner Kriminalpolizei, die in Deutschland eine Vorreiterrolle spielte und eine Vorbildfunktion auf ihrem Gebiet ausübte897, zu Beginn des Jahres 1920 nicht gerade auf dem Zenit ihres Ansehens stand. Die Ursachen für diese Krise sah der Autor aber offensichtlich nicht in der Kriminalpolizei, sondern ausschließlich in externen Faktoren. Dabei fasste er die Ergebnisse einer kurz zuvor stattge- 894 o. V., Die Polizei im Kampf mit dem Verbrechertum (15.1.1920), S. 529 f. 895 o. V., Die Polizei im Kampf mit dem Verbrechertum (15.1.1920), S. 530. 896 o. V., Die Polizei im Kampf mit dem Verbrechertum (15.1.1920), S. 529 f. 897 Vgl. Wagner, Volksgemeinschaft ohne Verbrecher, S. 79ff. IV. Die deutsche Polizei in der Zwischenkriegszeit 228 fundenen Tagung des Vereins der Kriminal-Oberwachtmeister Groß-Berlins zusammen, in der insbesondere eine stärkere Rolle der Kriminalpolizei im Strafprozess, eine bessere Bewaffnung der Beamten und eine großzügigere Besoldung und Absicherung der Hinterbliebenen von im Dienst getöteten Beamten gefordert wurde.898 Auch diese „Wunschliste“ veranschaulichte die unbefriedigenden Arbeitsbedingungen und die Unzufriedenheit der Kriminalbeamten. Im Mittelpunkt der Kritik stand aber die Justiz, wie die folgende Passage am Schluss des Beitrags noch einmal zeigte: „Die bisher geübte milde Praxis der Justizbehörden ist als Hauptgrund für das Überhandnehmen des gewerbsmäßigen Verbrechertums anzusehen. Dieser Umstand verleidet den Beamten die Dienstfreudigkeit und setzt sie steten Gefahren aus.“899 Neben dieser Kritik dürfte den Lesern dieses Beitrags aber ein weiterer Aspekt aufgefallen sein, nämlich der häufige Verweis auf das „gewerbsmäßige“, „berufsmäßige“ oder „gewohnheitsmäßige“ Verbrechertum als größte Gefahr für die innere Sicherheit in Deutschland und daher auch als zentrale Herausforderung der Kriminalpolizei, der in diesem kaum zwei Seiten langen Aufsatz nicht weniger als elf Mal erfolgte. Auch wenn dieser Begriff nach Einschätzung von Patrick Wagner „spätestens durch die Arbeiten der soziologischen Strafrechtsschule um [den 1919 verstorbenen] Franz von Liszt […] Allgemeingut der Kriminologie geworden [war]“900 und daher auch der Weimarer Polizei, vor allem aber der Kriminalpolizei nicht gänzlich fremd gewesen sein dürfte, so hielt es der Autor dennoch für notwendig, eine Definition zu liefern, die besagte, dass ein gewerbsmäßiger Verbrecher jemand sei, „der nur vom Ertrage seiner Verbrechen lebt und leben will“901. Insofern war das Konzept des ‚Berufsverbrechers‘ Anfang der Jahres 1920 zumindest in der Polizeipraxis noch erläuterungsbedürftig. Gleichwohl deuteten die Angaben in diesem Beitrag darauf hin, dass diese Form von Kriminalität einen enormen Anstieg erlebte, wie die folgende, auf der Tagung der Kriminal-Oberwachtmeister Groß-Berlins vorgestellte Quantifizierung verdeutlichte: „Während im Jahre 1914 in der Inspektion B des Polizeipräsidiums 24.663 berufsmäßige Verbrecher gezählt wurden, stieg diese Zahl 1918 898 Vgl. o. V., Die Polizei im Kampf mit dem Verbrechertum (15.1.1920), S. 530 f. 899 o. V., Die Polizei im Kampf mit dem Verbrechertum (15.1.1920), S. 531. 900 Wagner, Volksgemeinschaft ohne Verbrecher, S. 21. 901 o. V., Die Polizei im Kampf mit dem Verbrechertum (15.1.1920), S. 529. 1. Zusammenbruch und Neuaufbau (1918-23) 229 auf 45.511, 1919 auf 75.864. Im Jahre 1914 wurden 3.982 ‚schwere Jungens‘ zur Haft gebracht, 1918 6.395 und 1919 9.924.“902 Dies entsprach allein im Laufe des Jahres 1919 einer Steigerung um ca. 67% in Bezug auf die Anzahl der ‚berufsmäßigen Verbrecher‘ und um ca. 55% in Bezug auf die dazugehörigen Verhaftungen. Auch wenn die Zuverlässigkeit dieser quantitativen Angaben – vor allem in Bezug auf die Anzahl der ‚berufsmäßigen Verbrecher‘, die ja offenbar nicht den aktenmäßig erfassten Verhaftungen entsprechen konnte – angesichts der terminologischen Unschärfe dieses Begriffs und der offensichtlichen Messprobleme903 äußerst fragwürdig erschien, so ließ allein schon die Tatsache, dass die ‚gewerbsmäßige‘ Kriminalität in diesem Beitrag und auf der angesprochenen Tagung eine so prominente Rolle spielte, darauf schließen, dass diese in den folgenden Jahren eine zentrale Rolle im kriminalpolizeilichen Diskurs spielen würde. So erschien bereits sechs Monate später, im Juni 1920, ein Beitrag in der ZDPol, in dem sich der Polizeiinspektor Glocker aus St. Ingbert mit den Konsequenzen des Anstiegs dieser Form von Kriminalität für die Kriminalpolizei befasste.904 Interessanterweise vermied der Autor dabei den Begriff ‚gewerbsmäßiger Verbrecher‘, allerdings ließen seine Ausführungen – insbesondere seine Hinweise, dass die betreffenden Verbrecher ‚organisiert‘ und ‚spezialisiert‘ waren und ein „Gewerbe‘ ausübten – keinen Zweifel daran, dass er sich genau auf diese Form von Kriminalität bezog, wie die folgende Passage verdeutlichte: „Das schon vor dem Kriege recht zahlreich vorhandene Verbrechertum hat eine enorme Vermehrung erfahren und ist immer noch im Zunehmen begriffen. Es bedient sich zur Ausübung seines lichtscheuen Gewerbes aller erreichbaren technischen Hilfsmittel und geht mit einer Gerissenheit und Kühnheit zu Werke, die einer besseren Sache würdig wäre. Von organisierten Diebesbanden werden förmliche Streifzüge nach den verschiedensten Verkehrsrichtungen unternommen und Stadt und Land gebrandschatzt. […] Tatsache ist, daß der staatliche wie kommunale Sicherheitsdienst mit der ungewöhnlich starken Entwicklung des Verbrechertums nicht entfernt Schritt gehalten hat. Sowohl 902 o. V., Die Polizei im Kampf mit dem Verbrechertum (15.1.1920), S. 530. 903 Vgl. Wagner, Volksgemeinschaft ohne Verbrecher, S. 21ff. und S. 38ff. 904 Vgl. Glocker, (Vorname fehlt), Brauchen wir eine bewegliche Landeskriminalpolizei bzw. Landeskriminalgendarmerie? in: ZDPol, 17. Jg. (1920/21), Nr. 7 (24.6.1920), S. 149ff. IV. Die deutsche Polizei in der Zwischenkriegszeit 230 der Zahl wie auch hinsichtlich der beruflichen Ausbildung nach ist das Polizei- wie Gendarmerieinstitut dem mehr und mehr zum Spezialistentum ausgearteten Verbrechertum unterlegen.“905 Wie schon der nicht namentlich genannte Autor des zuvor behandelten, im Januar 1920 erschienenen Aufsatzes vertritt auch Glocker die Auffassung, dass das ‚gewerbsmäßige‘ Verbrechertum stark zugenommen habe und eine besondere Gefahr für die innere Sicherheit darstelle. Neu war hingegen die Deutlichkeit, mit der der Autor die Defizite der Polizei – und bei dieser Kriminalitätsform meinte er natürlich vor allem die Kriminalpolizei – bei der Bekämpfung dieser ‚Berufsverbrecher‘ ansprach. So kritisierte er nicht nur die zu geringe Anzahl an Polizeibeamten, sondern auch ihre ‚berufliche Ausbildung‘, die mit der zunehmenden Spezialisierung der entsprechenden Verbrecher nicht Schritt halten konnte. Im Ergebnis bedeuteten diese Aussagen das Eingeständnis, dass die Polizei auf diesem für sie zentralen Tätigkeitsfeld versagte und damit ihren gesetzlichen Auftrag nicht erfüllen konnte. Damit knüpfte der Autor an den drei weiter oben behandelten, im letzten Jahr in der ZDPol erschienen Beiträge an, deren gemeinsame Schnittstelle darin bestand, dass sie mehr oder weniger vage kausale Zusammenhänge zwischen drei krisenhaften Situationen oder Entwicklungen in den ersten Nachkriegsjahren herstellten, nämlich (1) der Krise der Weimarer Kriminalpolizei, (2) der unbefriedigenden allgemeinen Sicherheitslage in Deutschland und (3) dem Anstieg der ‚gewerbsmäßigen‘ Kriminalität. Dass es tatsächlich Zusammenhänge und Wechselwirkungen zwischen diesen Faktoren gab, ist offensichtlich, allerdings sollten diese nicht überbewertet werden. So resultierte die Krise der Kriminalpolizei vor allem aus der Tatsache, dass der unmittelbar nach dem Kriegsende erfolgte, starke Anstieg der politischen Gewalt und Straßenkriminalität weniger von Kriminalbeamten und vielmehr von Streifenbeamten und geschlossenen Polizeieinheiten bekämpft werden konnte. Die Rolle der ‚gewerbsmäßigen‘ Kriminalität dabei bzw. ihr Einfluss auf die allgemeine Sicherheitslage waren indes kaum zuverlässig einzuschätzen. So deutete die Kriminalitätsstatistik – wie weiter oben insbesondere in den Abbildungen 5 und 6 veranschaulicht wurde – eher darauf hin, dass der starke Anstieg der Kriminalität in den ersten Nachkriegsjahren vor allem auf die wirtschaftliche Not großer Teile der Bevölkerung zurückzuführen war, was wiederum dafür 905 Glocker, Brauchen wir eine bewegliche Landeskriminalpolizei (24.6.1920), S. 149. 1. Zusammenbruch und Neuaufbau (1918-23) 231 sprach, dass es sich eher um Gelegenheitstäter als um Berufsverbrecher handelte.906 In den hier behandelten Aufsätzen aus der ZDPol wurden die Krise der Weimarer Kriminalpolizei, die unbefriedigende Sicherheitslage und die ‚gewerbsmäßige‘ Kriminalität aber auf eine wenig transparente Art und Weise miteinander vermengt, so dass es nicht verwundert, dass Glocker in seinem Beitrag Lösungen vorschlug, die seiner Einschätzung nach geeignet waren, alle drei Problemlagen auf einmal zu lösen: „Nur ein mit den besten Fachkenntnissen ausgestattetes, im allgemeinen Sicherheitsdienst erprobtes, bewegliches, nicht an den Dienstsitz gebundenes Beamtenpersonal (Kriminalspezialisten) vermag den Spitzfindigkeiten und der Gerissenheit des heutigen Verbrechertums die Wage zu halten. […] Der Ausbau der Organisation des Gendarmerie- wie Polizeiwesens, insbesondere die Spezialisierung des Dienstbetriebes und die bestmögliche Schulung des für den Kriminaldienst in Aussicht genommenen, im allgemeinen Gendarmerie- oder Polizeidienst zuvor hinreichend erprobten Beamtenpersonals, erscheinen zweifellos als hervorstechende Faktoren zur Erzielung einer Besserung der Sicherheitsverhältnisse geeignet. […] Die Schaffung einer beweglichen, über das ganze Land verzweigten, unter engster Fühlungnahme mit der Staatsanwaltschaft arbeitenden, nach einheitlichen Grundsätzen organisierten, sich gegenseitig in die Hände arbeitenden Kriminalpolizei und Kriminalgendarmerie erscheint nach all dem Gesagten als eine vordringliche Aufgabe der Staatsbehörde.“907 Der vom Autor hier empfohlene Lösungsansatz basierte auf einer weitgehenden Spezialisierung und Zentralisierung der Kriminalpolizei auf allen Ebenen. Dies betraf die Vermittlung von Spezialwissen und -kenntnissen im Rahmen der Aus- und Fortbildung sowohl der Kriminalbeamten in den Städten wie auch der für kriminalpolizeiliche Angelegenheiten zuständigen Gendarmen in den ländlichen Gegenden, aber auch die Bildung von entsprechend spezialisierten Organisationseinheiten, d. h. Abteilungen oder Behörden, sowie eine zentralisierte Führung und Steuerung dieser Bereiche, die eine ganzheitliche Strafverfolgung über kommunale und Landesgrenzen hinweg ermöglichen sollte. Dass eine solche Spezialisierung und Zentralisierung der Kriminalpolizei in der Tat geeignet war, um gut organisierte, überregional agierende und hochgradig spezialisierte krimi- 906 Vgl. Wagner, Volksgemeinschaft ohne Verbrecher, S. 30ff. 907 Glocker, Brauchen wir eine bewegliche Landeskriminalpolizei (24.6.1920), S. 149ff. IV. Die deutsche Polizei in der Zwischenkriegszeit 232 nelle Vereinigungen – d. h. das ‚gewerbsmäßige‘ Verbrechertum – zu bekämpfen, erscheint sehr plausibel. Ob dieser Lösungsansatz hingegen eine erfolgversprechende Strategie zur Verbesserung der allgemeinen Sicherheitslage im Deutschland des Jahres 1920 darstellte, durfte hingegen zu Recht bezweifelt werden, da von Gelegenheitsverbrechern verübte Kleinkriminalität sowie Unruhen und Aufstände eher in den Zuständigkeitsbereich der Schutzpolizei fielen. Was der von Glocker vorgeschlagene Lösungsansatz aber mit sehr hoher Wahrscheinlichkeit wirksam bekämpfte, war die oben beschriebene Krise der Kriminalpolizei, da Spezialisierungsund auch Zentralisierungsprozesse in der Regel mit einer hochwertigeren Qualifikation, einem höheren beruflichen Ansehen bzw. Status sowie besseren Verdienstmöglichkeiten einhergehen. Diese Vorzüge einer Spezialisierung der Kriminalpolizei sprach er in seinem Beitrag sogar explizit an: „Es ist doch selbstverständlich und liegt schon im inneren Wesen der Sache, daß die Ernennung zum Kriminalgendarmen […] eine gewisse Beförderung darstellen muß, wenn sie überhaupt einen beruflichen Anreiz und ein unbedingt erforderliches Streben der besten Kräfte nach Erreichung dieser Durchgangsstellung darbieten soll. Ebenso selbstverständlich ist es, daß die Leiter von Gendarmeriestationen, denen eine eigene Kriminalabteilung angegliedert ist, […] gemäß der vermehrten Verantwortung und Arbeitslast unter Verleihung einer ihnen zukommenden Amtsbezeichnung – vorschlagsweise Gendarmeriekommissär oder Sicherheitskommissär – in eine sozial gehobene Stellung und somit auch in eine höhere Gehaltsklasse kommen müssen.“908 Insofern bestand durchaus Anlass zu der Vermutung, dass die häufigen Hinweise auf die Gefahren des ‚Berufsverbrechertums‘ und die von Glocker vorgeschlagene Spezialisierung und Zentralisierung der Kriminalpolizei im Sinne des dramaturgischen Ansatzes der Polizeisoziologie nur ‚Theater‘ bzw. ein ‚Schwindel‘ waren909 und vor allem der Verbesserung des beruflichen Status und der Arbeitsbedingungen der Kriminalbeamten dienen sollten, wohingegen die Vorzüge einer solchen Entwicklung bei der Verbesserung der allgemeinen Sicherheitslage in den Anfangsjahren der Weimarer Republik alles andere als eindeutig waren. Im Jahr 1920 war allerdings noch nicht absehbar, ob der vom Autor vorgeschlagene Lösungs- 908 Glocker, Brauchen wir eine bewegliche Landeskriminalpolizei (24.6.1920), S. 149 f. 909 Vgl. Manning, The police, S. 194ff. 1. Zusammenbruch und Neuaufbau (1918-23) 233 ansatz von den politischen Entscheidungsträgern aufgegriffen und realisiert werden und welche Auswirkung dies auf die Kriminalität und die Polizei haben würde. Wie weiter unten noch gezeigt werden wird, sollten sich die Kerngedanken dieses Beitrags aber als sehr zukunftsweisend herausstellen. Erfolgreiche Bewältigung polizeilicher Großlagen Die Bewältigung von polizeilichen Großlagen war eine der zentralen Herausforderung der Polizei in den Anfangsjahren der Weimarer Republik. Hierzu zählten – und zählen auch heute noch – insbesondere Demonstrationen, größere Unruhen, Krawalle oder gewaltsame Aufstände, die nur unregelmäßig vorkamen und wegen des damit verbundenen Risikos einer Gefährdung der öffentlichen Sicherheit polizeiliche Maßnahmen erforderten.910 Zuständig hierfür waren damals primär entsprechend spezialisierte Sicherheits- bzw. Schutzpolizeieinheiten, die in der Regel aus jungen, am Anfang ihres Berufslebens stehenden Beamten bestanden, die in Gemeinschaftsunterkünften untergebracht waren, im Einsatz als geschlossene Einheiten fungierten und bei Bedarf von regulären Beamten des polizeilichen Einzel- bzw. Streifendienstes unterstützt wurden. Heutzutage sind in Deutschland die Bereitschaftspolizeien des Bundes und der Länder für diesen Aufgabenbereich zuständig.911 Die besondere Bedeutung dieses polizeilichen Aufgabenfeldes in den Anfangsjahren der Weimarer Republik ergab sich nicht nur aus der relativen Häufigkeit von gewaltsamen Aufständen, Demonstrationen und sonstigen Unruhen, sondern auch aus der Tatsache, dass dieser Aufgabenbereich nach Ansicht von Christian Knatz als „Gradmesser für die Qualität der damaligen Polizeiarbeit“ galt und als „vornehmste Aufgabe“912 der Polizei angesehen wurde, was durchaus erstaunlich ist angesichts der Tatsache, dass es sich um einen Aufgabenbef) 910 Vgl. M. Kniesel, U. Behrendes, Demonstrationen und Versammlungen, in: M. Kniesel, E. Kube, M. Murck [Hrsg.], Handbuch für Führungskräfte der Polizei – Wissenschaft und Praxis, Lübeck 1996, S. 273ff.; P. A. J. Waddington, M. Wright, Police use of force, fire-arms and riot-control, in: T. Newburn [Hrsg.], Handbook of Policing, 2. Aufl., Cullompton u. a. 2008, S. 467, S. 471ff. 911 Vgl. A. Schmelzer, Sicherheitsföderalismus im Ausnahmezustand – Einsatz der Bundespolizei zur Unterstützung der Länder am Maßstab der Bundestreue, Baden-Baden 2015, S. 145ff.; Wilz, Die Polizei als Organisation, S. 120. 912 Knatz, Polizei in der Weimarer Republik, S. 44. IV. Die deutsche Polizei in der Zwischenkriegszeit 234 reich handelte, für den im Kaiserreich nicht die Polizei, sondern das Heer zuständig gewesen war.913 Die Bekämpfung von gewaltsamen Aufständen, die in diesen ersten Jahren der Republik überwiegend, aber nicht ausschließlich vom linksextremen politischen Lager ausgingen, gestaltete sich von Anfang an als äußerst schwierig. Den Anfang machten diesbezüglich die gewaltsamen Unruhen in Ruhrgebiet im März und April 1920, bei denen die Sicherheitspolizei zunächst eine schwere und als demütigend empfundene Niederlage gegen die ‚Rote Ruhrarmee‘ hinnehmen musste.914 Diese Niederlage hatte nachhaltige Auswirkungen auf die kollektiven Einstellungen und Überzeugungen der Polizeibeamten, in denen sich als psychische Reaktion auf die demütigenden Erfahrungen die Vorstellung des Arbeiters als Feindbild der Polizei verfestigte. Als sich die Sicherheitspolizei dann – nach der Niederschlagung des Aufstandes durch Reichswehr- und Freikorpseinheiten – am anschließenden ‚Rachefeldzug‘ gegen die Bevölkerung beteiligte, verfestigte sich in den unteren Bevölkerungsschichten wiederum die Vorstellung des Polizisten als gewalttätigen ‚Bluthund‘.915 Dieses bereits im zweiten Jahr der Weimarer Republik stattgefundene Ereignis hatte einen dauerhaften und negativen Einfluss auf die Beziehungen zwischen Polizei und Arbeiterschaft. Daniel Schmidt spricht in diesem Zusammenhang sogar von „unüberwindliche[n] Gräben“, die über die Weimarer Zeit hinaus reichen sollten.916 In der ZDPol fand dieser Polizeieinsatz keine direkte Erwähnung, was angesichts der Tatsache, dass dieser wenig erfolgreiche Einsatz von der in diesem Medium regelmäßig heftig kritisierten Sicherheitspolizei durchgeführt wurde, etwas überraschend ist. Eine indirekte, vorsichtig formulierte Kritik ließ sich höchstens im Beitrag des bereits oben mehrmals zitierten Breslauer Polizeiinspektors und stellvertretenden Vorsitzenden der Vereinigung der staatlichen höheren Polizei-Exekutivbeamten Preußens Heinrich Eiben erahnen, der wenige Wochen nach der Niederschlagung dieses Aufstandes am 13. Mai 1920 erschien.917 Darin merkte er an: 913 Vgl. Leßmann-Faust, Geschichte der Polizei, S. 18. 914 Vgl. Eliasberg, Der Ruhrkrieg von 1920, Bonn 1974, S. 133ff.; Hürten, Bürgerkriege in der Republik, S. 90ff. 915 Vgl. Schmidt, Schützen und Dienen, S. 74ff.; Leßmann-Faust, Die Preußische Schutzpolizei, S. 79. 916 Vgl. Schmidt, Schützen und Dienen, S. 75 f. (Zitat: S. 76). 917 Vgl. Eiben, Die Forderung des Tages (13.5.1920), S. 93 f. 1. Zusammenbruch und Neuaufbau (1918-23) 235 „Sie [die jüngsten inneren Wirren] bestätigen leider unsere Befürchtungen, daß die Schöpfer des bisherigen Planes weder die Forderungen der Mehrheit unseres Volkes recht gewürdigt noch es verstanden haben, ein Werk zu schaffen, das imstande ist, seine Aufgaben zu erfüllen. Anstatt Ruhe und Frieden zu sichern, ist der Zwietracht neue Nahrung gegeben worden. Die Unsicherheit hat sich immer weiter ausgebreitet, und die Männer, die in der Bekämpfung der Friedensstörer die meiste Übung haben, und deren erster Wunsch und ernster Wille es ist, ihre Erfahrungen und Kräfte voll zur Gesundung der kranken Berufs- und Volksschichten einzusetzen, sind zum größten Teil lahmgelegt und zur Unfruchtbarkeit verurteilt worden.“918 Angesichts des zeitlichen Zusammenhangs liegt die Vermutung nahe, dass sich diese Passage auf den Aufstand im Ruhrgebiet am 13. Mai 1920 und die Schwierigkeiten der Sicherheitspolizei bei seiner Bekämpfung bezog. Die Ursache für diese Probleme sah Heinrich Eiben – wie er auch in seinen zahlreichen anderen, oben behandelten Beiträgen immer wieder betonte – in der Verdrängung der ehemaligen, zivil geprägten Schutzmannschaft durch die neue, militärisch orientierte Sicherheitspolizei, die seiner Meinung nach unter den damaligen Rahmenbedingungen ungeeignet war, für Ruhe und Ordnung zu sorgen. Angesicht der Tatsache, dass Heinrich Eiben als ehemaliger Angehöriger der Schutzmannschaft hinsichtlich dieser Frage sicherlich alles andere als unparteiisch war, darf die Objektivität dieser Analyse durchaus angezweifelt werden. Dies gilt umso mehr, wenn man berücksichtigt, dass die Niederschlagung von größeren Aufständen im Kaiserreich in den Zuständigkeitsbereich des Heeres fiel, so dass seine Einschätzung, dass die ehemaligen Schutzmänner diesbezüglich „die meiste Übung haben“, wenig überzeugend gewirkt haben dürfte. Vermutlich war die begrenzte Leistungsfähigkeit der Polizei – und zwar sowohl der Ordnungs- wie auch der Sicherheitspolizei – bei der Niederschlagung von größeren Aufständen nicht nur dem Autor, sondern auch seiner Leserschaft im Prinzip bewusst, was auch erklären könnte, warum seine Kritik so vage und zaghaft ausfällt und warum der Polizeieinsatz zur Bekämpfung der gewaltsamen Unruhen in Ruhrgebiet im März und April 1920 in der ZDPol – ganz im Gegensatz zu den in den nächsten Jahren folgenden, ähnlich gelagerten Polizeieinsätzen – nicht genauer dargestellt und diskutiert wurde. 918 Eiben, Die Forderung des Tages (13.5.1920), S. 93. IV. Die deutsche Polizei in der Zwischenkriegszeit 236 Nach der Auflösung der Sicherheitspolizei im Oktober 1920 musste die neue Schutzpolizei „ihre erste große Bewährungsprobe“919 im März 1921 bestehen, als der ‚Mitteldeutsche Aufstand‘ – eine von der KPD gesteuerte Arbeiterrevolte – ausbrach.920 Hier wählte die Polizei auf Anweisung des sozialdemokratischen Oberpräsidenten der Provinz Sachsen, Otto Hörsing, zunächst eine auf Deeskalation abzielende Einsatztaktik, bei der die Polizei in der Arbeiterschaft explizit um Verständnis für ihr Vorgehen warb und eine gewaltlose Konfliktlösung auf dem Verhandlungsweg suchte. Dieses defensive Vorgehen wurde sogar noch beibehalten, als der Konflikt am 23. März 1921 eskalierte, bewaffnete Kämpfe ausbrachen und die Polizei unter Beschuss geriet. Am 24. März 1921 wurde die Deeskalationsstrategie allerdings auf Betreiben der Reichsregierung wie auch der preußischen Regierung aufgegeben und mit der Verhängung des Ausnahmezustands eine auf massivem Waffeneinsatz beruhende, militärischen Taktiken folgende Niederschlagung des Aufstandes durch Schutzpolizeieinheiten angeordnet. Gegen die ca. 4.000 schwerbewaffneten Polizisten waren die zahlenmä- ßig weit unterlegenen Aufständischen chancenlos, so dass die Kämpfe nach wenigen Tagen mit mindestens 145 zivilen Todesopfern, von denen einige nachweislich aus widerrechtlichen Hinrichtungen durch die Polizei resultierten, beendet wurde. Angesichts der sich darin widerspiegelnden Missachtung der Prinzipien der Gesetzmäßigkeit und Verhältnismäßigkeit durch die Polizei hält es Christian Knatz für „legitim, cum grano salis, für die Zeit vom 19. bis zum 25. März 1921 von einem Polizeieinsatz, für die folgenden Tage von einem Militäreinsatz ohne Militär in Mitteldeutschland zu sprechen“921. Während in der Presse und den Parlamenten der mit militärischen Mitteln erzielte Erfolg der Polizeitruppen auf positive Resonanz stieß, wurde die von Otto Hörsing zunächst gewählte, deeskalative polizeiliche Einsatztaktik nicht als Beleg für die zunehmende Demokratisierung und Verbürgerlichung der Polizei, sondern als Zeichen der Schwäche gewertet und für gescheitert erklärt.922 Ein erster, wenn auch vage gehaltener Beleg für die angesprochene positive Resonanz auf den mit militärischen Einsatztaktiken erzielten Erfolg der Polizei fand sich am 5. April 1921 im Geleitwort des Ministerialdiri- 919 Knatz, Polizei in der Weimarer Republik, S. 44. 920 Vgl. Winkler, Von der Revolution zur Stabilisierung, S. 516ff.; Schwabe, Der Weg der Republik, S. 99 f.; Schumann, Politische Gewalt, S. 109ff. 921 Knatz, „Ein Heer im grünen Rock“, S. 248. 922 Vgl. Knatz, „Ein Heer im grünen Rock“, S. 88ff.; Knatz, Polizei in der Weimarer Republik, S. 44ff.; Leßmann-Faust, Die Preußische Schutzpolizei, S. 92ff.; Leßmann, Mit‚Manneszucht, S. 80ff. 1. Zusammenbruch und Neuaufbau (1918-23) 237 genten und späteren Staatssekretärs im preußischen Innenministerium Wilhelm Abegg zur ersten Ausgabe des neuen Jahrganges 1921/22 der ZD- Pol, in dem er feststellte: „Die durch die Verschmelzung der blauen und grünen Polizei geschaffene Einheitsorganisation hat gerade in dieser Zeit eine glänzende Probe bestanden, die nicht nur für die richtige Organisation der Polizei, für Aufbau und Gliederung, sondern auch für den vorzüglichen Geist der Beamtenschaft zeugt, die sich des rechten Weges wohl bewußt ist […].“923 Angesichts des unmittelbaren zeitlichen Zusammenhangs dürfte dem Leser – auch ohne konkrete Benennung des Aufstandes – klar gewesen sein, dass das hier ausgesprochene Lob dem Polizeieinsatz zur Niederschlagung des Mitteldeutschen Aufstandes galt. Deutlicher wurden dann in der folgenden, vierzehn Tage später erschienenen Ausgabe der ZDPol der Reichskanzler Constantin Fehrenbach, der preußische Ministerpräsident Otto Braun und der Berliner Polizeipräsident Wilhelm Richter in ihrer Danksagung an die Schutzpolizei, in der die verschiedenen Aufstandsregionen ganz konkret benannt und der Polizeieinsatz überschwänglich gelobt wurden. „Durch das tatkräftige Eingreifen der Schutzpolizei ist es gelungen, die dem Lande und der Bevölkerung drohende Gefahr rechtzeitig im Keime zu ersticken. Bei dauernder, tagelanger Bereitschaft hat die Schutzpolizei in nervenaufreibendem Dienst und treuer Pflichterfüllung […] bewiesen, daß sie ein festes Werkzeug in der Hand der Regierung ist und ihre ganze Kraft eingesetzt hat, um ihr Treuegelöbnis zur Verfassung zu erfüllen. Nur den opferwilligen Leistungen der Beamtenschaft und der umsichtigen Führung ist der Erfolg zuzuschreiben. […] Das entschlossene, tatkräftige und gleichzeitig besonnene und umsichtige Wirken der Schutzpolizei während der unruhigen Tage hat bei der gesamten Bevölkerung Anerkennung gefunden und war die erste Probe der jungen Schutzpolizei auf ihre Leistungsfähigkeit.“924 Dabei lobten sie nicht nur die erfolgreiche Niederschlagung des Aufstandes, sondern betonten auch explizit die Verfassungstreue der Polizei und ihre Loyalität zur Regierung, womit sie ausdrücken wollten, dass die Re- 923 Abegg, Geleitwort (5.4.1921), S. 2. 924 C. Fehrenbach, O. Braun, W. Richter, Der Dank der Regierung an die Schutzpolizei, in: ZDPol, 18. Jg. (1921/22), Nr. 2 (20.4.1921), S. 36. IV. Die deutsche Polizei in der Zwischenkriegszeit 238 gierung die Polizei – ganz im Sinne des Titels der vorliegenden Dissertation – als Instrument staatlicher Herrschaft betrachtete und dass sie diese Funktion in den letzten Wochen äußerst effektiv erfüllt hatte. Auffällig ist der mehrfache Hinweis auf das „umsichtige“ bzw. „besonnene“ Vorgehen der Polizeibeamten, das angesichts des in der Literatur sehr gut dokumentierten, ab dem 26. März 1921 auf massivem Schusswaffeneinsatz beruhenden und mit zahlreichen gewaltsamen Übergriffen und Grausamkeiten verbundenen Polizeieinsatzes und der Vielzahl an unmittelbar im Anschluss an die Kampfhandlungen eröffneten Strafverfahren gegen Polizeibeamte nicht der Realität entsprach und sicherlich als bewusste Irreführung der Leserschaft dieser Zeitschrift zu werten ist.925 Im gleichen Heft der ZDPol erschien auch eine sehr detaillierte Beschreibung des polizeilichen Einsatzgeschehens in Mitteldeutschland, die der amtlichen Denkschrift des preußischen Innenministeriums entnommen war.926 Dieser bereits am 20. April 1921 und damit lediglich ca. zwei Wochen nach der Niederschlagung des Aufstandes veröffentlichte Bericht diente zwar sicherlich der Herstellung einer gewissen Transparenz in Bezug auf die für die Polizei zweifelsohne hochrelevanten Geschehnisse, allerdings lieferte er eine sehr einseitige und unkritische, teilweise auch verzerrte und irreführende Interpretation der Ereignisse. Wie einseitig die Darstellung erfolgte, zeigte sich schon zu Beginn des Beitrags, als in Bezug auf die Ursachen für den Ausbruch festgestellt wurde: „Der kommunistisch verhetzte Teil der Arbeiterschaft sah in dieser Belegung des Industriegebiets mit Schutzpolizei den willkommenen Anlaß zu Streik und Aufruhr. Seit Monaten von skrupellosen Hetzern bearbeitet, war der Boden für den Aufruhr günstig vorbereitet.“927 Diese etwas polemisch wirkende, einseitige Schuldzuweisung an die Arbeiterschaft war angesichts der in der Literatur kontrovers diskutierten Hinweise, dass der Aufstand möglicherweise vom preußischen Innenministerium provoziert wurde928, sowie der offensichtlich manipulativen sprachlichen Formulierung sehr fragwürdig und sicherlich wenig geeignet, dem Leser ein objektives und zutreffendes Bild der Geschehnisse zu vermitteln. 925 Vgl. Knatz, „Ein Heer im grünen Rock“, S. 195ff.; Schumann, Politische Gewalt, S. 134ff. 926 Vgl. o. V., Darstellung der Bekämpfung des Aufruhrs in Mitteldeutschland durch die Schutzpolizei, in: ZDPol, 18. Jg. (1921/22), Nr. 2 (20.4.1921), S. 31ff. 927 o. V., Darstellung der Bekämpfung des Aufruhrs (20.4.1921), S. 31. 928 Vgl. Knatz, „Ein Heer im grünen Rock“, S. 38ff. und insb. S. 50ff. 1. Zusammenbruch und Neuaufbau (1918-23) 239 Und auch die weiteren Darstellungen des Innenministeriums entbehrten jeglicher Selbstkritik, ignorierten mögliche Fehler oder Übergriffe der Polizei und zielten schon aufgrund der gewählten sprachlichen Mittel offensichtlich darauf ab, die am Aufstand beteiligten Personen möglichst negativ, das Verhalten und die Haltung der an der Niederschlagung dieses Aufstandes beteiligten Polizeibeamten hingegen möglichst positiv darzustellen, so dass man den Schilderungen einen propagandistischen Charakter zuschreiben kann.929 So wurden die Aufständischen u. a. als „Banden, die sich abseits der Hauptstraßen plündernd, brandschatzend und mordend auf dem flachen Lande umhertrieben“, und „sich umhertreibende[n] Banden, die der Schrecken der Bevölkerung geworden waren“930, bezeichnet. Noch deutlicher waren die Formulierungen in einem ergänzenden, vierzehn Tage später – d. h. am 5. Mai 1921 – in der folgenden Ausgabe dieser Zeitschrift erschienenen, ebenfalls der Denkschrift des preußischen Innenministeriums entnommenen Beitrag.931 Dort wurde in Bezug auf die Aufständischen festgestellt: „Fast jedes Industriestädtchen und Dorf standen unter kommunistischem Terror. […] Vom 3. Abschnitt an kämpften die Aufrührer nur aus dem Hinterhalt und in niederträchtigster Weise. […] Die Grausamkeit der Aufrührer ging über alles denkbare Maß. Die Leichen der bei Gröbers gefallenen Beamten waren auf entsetzliche Weise verstümmelt. Gefangene machten die Aufrührer grundsätzlich nicht. Was in ihre Hand kam, wurde totgeschlagen.“932 In starkem Kontrast dazu standen die Beschreibungen des Auftretens und des Verhaltens der eingesetzten Schutzpolizeikräfte, die durchgängig sachlich gehalten, am militärischen Sprachgebrauch orientiert waren und mit positiven Attributen belegt wurden, wie die folgenden Passagen zeigten: 929 Unter Propaganda soll hier verstanden werden „the deliberate, systematic attempt to shape perceptions, manipulate cognitions, and direct behavior to achieve a response that furthers the desired intent of the propagandist“. G. S. Jowett, V. O’Donnell, Propaganda and Persuasion, 4. Aufl., Thousand Oaks 2006, S. 7. 930 o. V., Darstellung der Bekämpfung des Aufruhrs (20.4.1921), S. 32 und S. 35. 931 Vgl. o. V., Erfahrungen und Bemerkungen aus der Bekämpfung des Aufruhrs in Mitteldeutschland durch die Schutzpolizei, in: ZDPol, 18. Jg. (1921/22), Nr. 3 (5.5.1921), S. 60ff. 932 o. V., Erfahrungen und Bemerkungen aus der Bekämpfung des Aufruhrs (5.5.1921), S. 60 f. IV. Die deutsche Polizei in der Zwischenkriegszeit 240 „Die Befreiung der Hundertschaft gelang rasch und wirksam. […] Die Leitung entschloß sich daher zu einem sofortigen überraschenden Angriff auf das Leunawerk und für diesen zu einem Nachtmarsch der Gruppe Poninski, ungeachtet der großen Anstrengungen, die sie bereits in den letzten Tagen hinter sich hatte. […] Nach Artillerievorbereitung, die um 6,30 Uhr vormittags einsetzte, nahm Graf Poninski um 7 Uhr vormittags nach kurzem Widerstand das Werk […] ein. Es wurden hierbei zunächst etwa 1200 Aufrührer verhaftet. […] Der Gegner hatte starke Verluste, darunter 60-70 Tote. […] Die eigenen Verluste bei dem Sturm auf Leuna waren gering.“933 „Haltung und Leistung der Beamtenschaft waren ausgezeichnet. Für den 25 Kilometer langen Nachtmarsch der Gruppe Graf Poninski in der Nacht vom 28. zum 29. März, Bereitstellung und Sturm auf das Werk im Anschluß an drei anstrengende Marsch- und Gefechtstage gebührt der Beamtenschaft hohes Lob. […] Die Haltung der Schutzpolizeibeamten bei der Unterdrückung der Unruhen ist hoher Anerkennung wert, zumal die schweren Kämpfe schmerzliche Verluste in ihren Reihen gefordert haben.“934 Im Kontext dieser gerade geradezu ‚glorifizierenden‘ Schilderungen des Polizeieinsatzes griff das Innenministerium in diesen Publikationen sogar zu falschen, den Leser bewusst irreführenden Darstellungen. So wurde beispielsweise in Bezug auf die Bewaffnung der Polizei festgestellt: „Die Bewaffnung der Schutzpolizei war infolge der Einschränkungen durch die Entente völlig unzureichend. […] Jeder in diesem Bezirk kämpfende Aufrührer hatte außerdem ein Gewehr. Man kann darnach ermessen, was der Kampf gegen einen solchen Gegner für einen Polizeikörper bedeutet, von dem nur jeder dritte Mann mit einem Karabiner ausgestattet ist und der kaum über Maschinengewehre verfügt.“935 Dabei war die hier erwähnte, von der Interalliierten Militär-Kontrollkommission festgelegte Beschränkung der Bewaffnung der Polizei zwar grundsätzlich korrekt, allerdings wurden diese Auflagen bei der Bekämpfung des Mitteldeutschen Aufstandes unterlaufen, so dass jeder eingesetzte Polizist sowohl über einen Karabiner als auch über eine Pistole und jede Hundert- 933 o. V., Darstellung der Bekämpfung des Aufruhrs (20.4.1921), S. 34 f. 934 o. V., Erfahrungen und Bemerkungen aus der Bekämpfung des Aufruhrs (5.5.1921), S. 61 f. 935 o. V., Erfahrungen und Bemerkungen aus der Bekämpfung des Aufruhrs (5.5.1921), S. 61. 1. Zusammenbruch und Neuaufbau (1918-23) 241 schaft zudem noch über vier Maschinenpistolen und ein Maschinengewehr verfügten.936 Neben solchen Falschangaben enthielten die beiden Texte aber auch einige gegen die Aufständischen gerichtete Anschuldigungen, deren Wahrheitsgehalt schon aufgrund ihres spekulativen, kaum einer Überprüfung zugänglichen Charakters sehr fragwürdig erscheinen mussten und für die auch keinerlei Belege angeführt wurden, wie beispielsweise die Behauptung, dass „viele waffenfähige Männer […] festgehalten, mit Waffen ausgerüstet und, zum Teil mit Zwang, in die ‚Rote Armee‘ eingestellt“937 wurden, oder der Hinweis auf ein „wohlorganisiertes Radfahrerpatrouillensystem der Aufrührer“, das „sich unter der Maske harmloser Ausflügler besonders auffällig in den ersten Tagen der Operation“938 verbarg. Insgesamt entsteht der Eindruck, dass die Veröffentlichung dieser beiden, aus einer Denkschrift des preußischen Innenministeriums entnommenen Beiträge nicht nur der Information des aus Polizeibeamten bestehenden Zielpublikums dieser Zeitschrift diente, und dass hiermit auch nicht nur die Wertschätzung des Einsatzes der Polizeibeamten ausgedrückt werden sollte, sondern dass recht eindeutig versucht wurde, eine feindselige Haltung gegenüber den kommunistischen Teilen der Arbeiterschaft in der Leserschaft zu erzeugen bzw. zu verstärken. Dies ist angesichts der illegalen, gewaltsamen Aktivitäten der Aufständischen und der erheblichen Verluste auf Seiten der Polizei teilweise auch nachvollziehbar. Gleichwohl hätte den verantwortlichen Personen im Innenministerium klar sein müssen, dass solche einseitigen, manipulativen Darstellungen geeignet waren, beim Leser eine unzulässige Generalisierung dahingehend zu bewirken, dass Angehörige der Arbeiterklasse tendenziell als ‚Feindbild‘ angesehen wurden. Angesichts der Tatsache, dass der weit überwiegende Teil der unteren Bevölkerungsschichten dem linken politischen Spektrum zuzurechnen war und dass ein erheblicher Teil sogar mit dem Kommunismus sympathisiert haben dürfte, erscheinen diese vom SPD-geführten preußischen Innenministerium veranlassten Publikationen in der ZDPol unverantwortlich und wenig geeignet, die Entwicklung der Polizei zu einer bürgerorientierten, allen Bevölkerungsschichten gleichermaßen dienenden, „republikanischen Polizei“939 zu befördern. Gleichwohl belegte die ausführliche 936 Vgl. Knatz, „Ein Heer im grünen Rock“, S. 88. 937 o. V., Darstellung der Bekämpfung des Aufruhrs (20.4.1921), S. 32. 938 o. V., Erfahrungen und Bemerkungen aus der Bekämpfung des Aufruhrs (5.5.1921), S. 61. 939 Rosseburg, Gemeinnützige Tätigkeit der Polizei (27.5.1920), S. 114. IV. Die deutsche Polizei in der Zwischenkriegszeit 242 Darstellung des zweifelsohne erfolgreichen Polizeieinsatzes bei der Niederschlagung des Mitteldeutschen Aufstandes, dass die Schutzpolizei im Jahr 1921 zumindest auf dem Gebiet der polizeilichen Großlagen ein leistungsfähiges Instrument staatlicher Herrschaftssicherung geworden war. Angesichts dieses mit militärischen Einsatztaktiken erzielten Erfolgs verwundert es nicht, dass beim nächsten größeren Aufstand, den die Schutzpolizei zu bewältigen hatte, nämlich den kommunistischen Aufstand am 23. Oktober 1923 in Hamburg940, von vornherein auf deeskalative Einsatztaktiken verzichtet und stattdessen eine gewaltsame, einer militärischen Logik folgende Konfliktlösung gewählt wurde. Nach anfänglichen Erfolgen der nur schwach bewaffneten Aufständischen, denen es gelang, 17 der 26 Polizeiwachen in Hamburg zu erobern, ergriff die Polizei eine konventionelle Militärtaktik und schlug innerhalb von zwei Tagen den Aufstand brutal nieder. Wie auch schon bei der Niederschlagung des Mitteldeutschen Aufstandes wurde auch hier keine Konfliktlösung auf dem Verhandlungswege gesucht, sondern ein Vorgehen gewählt, das unter Missachtung der Prinzipien der Gesetzmäßigkeit und Verhältnismäßigkeit den massiven Einsatz von Schusswaffen vorsah und dabei den Tod von zahlreichen unbeteiligten Passanten nicht nur in Kauf nahm, sondern angesichts von Schießbefehlen auf Passanten und offene Fenster geradezu einforderte.941 Wie schon beim Mitteldeutschen Aufstand von 1921 veröffentlichte die ZDPol auch nun wieder relativ zeitnah einen Artikel, der sich mit den Hamburger Unruhen von 1923 beschäftigte. In diesem Fall handelte es sich um einen relativ ausführlichen, am 20. Januar 1924 und 5. Februar 1924 – d. h. ca. zwei Monate nach der Niederschlagung des Aufstandes – in zwei Teilen erschienenen Beitrag des Hamburger Polizeioberstleutnants Lothar Danner, in welchem er den entsprechenden Polizeieinsatz zunächst beschrieb und dann daraus Handlungsempfehlungen für zukünftige Einsätze ableitete.942 Besonders auffällig war hierbei – gerade im Vergleich zu den oben erörterten Ausführungen des preußischen Innenministeriums zur Niederschlagung des Mitteldeutschen Aufstands – das Bestreben des Autors, seinen Beitrag möglich sachlich und neutral zu formulieren und auf positive wie negative Wertungen möglichst zu verzichten. So 940 Vgl. Broué, The German Revolution, S. 791ff.; Kolb, Deutschland, S. 77 f.; Thoß, Demokratie ohne Demokraten, S. 59 f.; Winkler, Von der Revolution zur Stabilisierung, S. 621ff. 941 Vgl. Knatz, Polizei in der Weimarer Republik, S. 46 f. 942 Vgl. L. Danner, Bericht über die Unruhen in Hamburg vom 20.-26.10.1923, in: ZDPol, 20. Jg. (1923/24), Nr. 20 (20.1.1924), S. 333ff., Nr. 21 (5.2.1924), S. 353ff. 1. Zusammenbruch und Neuaufbau (1918-23) 243 bezeichnete er die Aufständischen durchgängig als ‚Aufständische‘, ‚Aufrührer‘ oder ‚Kommunisten‘ und verzichtete auf herabwürdigende oder beleidigende Bezeichnungen wie ‚Hetzer‘ oder ‚Pöbel‘, wie sie in anderen, oben dargestellten Beiträgen in dieser Zeitschrift durchaus üblich waren. Teilweise konnte man im Text sogar Hinweise darauf finden, dass Lothar Danner einen gewissen Respekt vor den militärischen Leistungen der Aufständischen zu empfinden schien: „Der strategische Gedanke, den die Kommunisten ihrem Anschlage zugrunde gelegt haben, läßt Verständnis für die verwundbaren Fronten der Stadt Hamburg erkennen. Der Plan war nach den Gesichtspunkten angelegt, die Stadt durch Umzingelung mit einem Schlage von allen Seiten konzentrisch anzugreifen. Zu diesem Zwecke sollten zunächst die im Halbkreis um Hamburg liegenden Außenwachen gestürmt werden, um nach Schaffen dieser Operationsbasis gegen das Innere weiter vorzudringen. […] Weiter hatten die Kommunisten sehr richtig erkannt, daß das Stadtgebiet Hamburg durch die Außenalster in zwei Teile geteilt wird und zur Verbindung dieser beiden Stadtteile die Krugkoppelbrücke eine ausschlaggebende Bedeutung spielt.“943 Der sich in diesen Ausführungen widerspiegelnde, sachlich-neutrale Sprachstil wurde von Lothar Danner in einem Beitrag durchgängig verwendet und fand sich dementsprechend auch bei seinen Schilderungen der Aktivitäten der eingesetzten Polizeibeamten. Dabei verzichtete er auf emotionsgeladene Aussagen und insbesondere auf jegliches Lob für den Polizeieinsatz, obwohl dies angesichts der erfolgreichen Niederschlagung des Aufstandes durch die Polizei und der Tatsache, dass es sich hier um einen Beitrag eines hochrangigen Hamburger Polizeibeamten in einer Zeitschrift, die sich nahezu ausschließlich an Polizeibeamte richtete, durchaus möglich und nachvollziehbar gewesen wäre. Hinzu kam, dass der Autor anscheinend an einer weitgehend realitätsgetreuen Schilderung der Ereignisse interessiert war und dementsprechend auch – anders als in der oben behandelten Darstellung des Polizeieinsatzes während des Mitteldeutschen Aufstandes von 1921 durch das preußische Innenministerium – relativ offen Defizite der Polizei anführte und Situationen ansprach, in denen die Polizei größere Schwierigkeiten hatte oder die von ihr gewählte Taktik nicht aufging. 943 Danner, Bericht über die Unruhen in Hamburg (20.1.1924), S. 333. IV. Die deutsche Polizei in der Zwischenkriegszeit 244 „Da sich die Kräfte als zu schwach erwiesen, um den Gegner niederzukämpfen, wurde die 13. Wachbereitschaft des Stadtbezirks Altona angesetzt mit dem Auftrage, die Polizeiwache 42 zu nehmen und die Aufruhre in Eimsbüttel niederzuschlagen. Aber auch dieser Kräfteeinsatz erwies sich zum Lösen des Auftrags noch als unzureichend. Die Gegenwehr der Aufrührer war außerordentlich hartnäckig. […] Nach Wiedereinnahme der Polizeiwache 42 wurden sofort energische Säuberungsaktionen durchgeführt und hierbei zahlreiche Personen, die sich an dem Aufruhr beteiligt hatten, festgenommen. Auch wurden zahlreiche Waffen und Munition gefunden, jedoch war die Zahl der Leute, die mit Waffen getroffen wurden, sehr gering. Erheblich schwieriger war es, im Aufruhrgebiet Barmbeck [sic] wieder Herr der Lage zu werden. Zunächst waren dort Teilkräfte eingesetzt, die sich aber zu schwach erwiesen, zumal ein großer Teil der Barmbecker [sic] Bevölkerung auf Seiten der Aufrührer stand.“944 Das mehrfache Eingeständnis von Schwäche, der Hinweis auf die geringe Zahl an festgenommenen bewaffneten Aufständischen und die Anspielung auf die fehlende Unterstützung der Polizei von Seiten der Bevölkerung können als Indiz für eine gewisse Bereitschaft der Polizei zu Offenheit und Selbstkritik gesehen werden. Allerdings sollte dies nicht überbewertet werden, da auch dieser Beitrag alles andere als eine objektive, ausgewogene Wiedergabe des Einsatzgeschehens bei der polizeilichen Bekämpfung dieses Aufstandes darstellte. So widersprach beispielsweise die hier erwähnte, angebliche Unterstützung der Aufständischen durch die Bevölkerung Christian Knatzs Feststellung, dass es „Unterstützung durch die Bevölkerung [… für die Aufständischen …] praktisch nicht [gab]“, und auch das martialische Vorgehen der Polizei, dem zahlreiche Unbeteiligte zum Opfer fielen945, blieb komplett unerwähnt. Dass auch eine sachliche Darstellungsweise durchaus irreführend auf den Leser wirken konnte, zeigte nicht zuletzt auch Lothar Danners nüchterne Anmerkung, dass „sich das Verbot sehr bewährt [hatte], nach der Straße gelegene Fenster zu öffnen“946, das einen wenig überzeugenden Rechtfertigungsversuch für den unverhältnismäßigen Schießbefehl auf offene Fenster darstellte. Gleichwohl muss konstatiert werden, dass sich Lothar Danners sachlichneutrale, auf die Herausstellung der polizeilichen Erfolge verzichtende 944 Danner, Bericht über die Unruhen in Hamburg (20.1.1924), S. 334. 945 Vgl. Knatz, Polizei in der Weimarer Republik, S. 46 f. (Zitat: S. 46). 946 Danner, Bericht über die Unruhen in Hamburg (5.2.1924), S. 353. 1. Zusammenbruch und Neuaufbau (1918-23) 245 Darstellung der Ereignisse während des Hamburger Aufstandes von 1923 sehr deutlich von der oben betrachteten, wesentlich einseitigeren, irreführenderen und manipulativeren Schilderung des Polizeieinsatzes während des Mitteldeutschen Aufstandes von 1921 durch das preußische Innenministerium abhob. Auch wenn der Autor sicherlich keine in jeder Hinsicht objektive und wahrheitsgetreue Analyse der Geschehnisse lieferte, so konnte man ihm aber sicherlich nicht die Absicht unterstellen, mit seiner Publikation eine feindselige Haltung gegenüber den Aufständischen bei seiner Leserschaft erzeugen oder verstärken zu wollen. Vielmehr deutete der sachlich gehaltene Beitrag darauf hin, dass die Polizei – oder zumindest Teile von ihr – sich zwischenzeitlich der Probleme bewusst geworden war, die aus der Entfremdung von Polizei und großen Teilen der unteren Bevölkerungsschichten resultierten, und daher im Rahmen von solchen Publikationen bewusst darauf verzichtete, diese Konflikte weiter zu vertiefen. Besonders deutlich wurde das eben konstatierte zunehmende Problembewusstsein im ebenfalls Anfang des Jahres 1924 in der ZDPol erschienenen Beitrag des promovierten Polizeiobersts Hermann Schützinger mit dem Titel „Neue Wege der Schutzpolizei“.947 In diesem Artikel, der wegen seiner Länge in drei Teilen publiziert wurde, beschäftigte er sich ausführlich mit den zentralen Herausforderungen der Schutzpolizei in dieser Zeit, indem er die großen Polizeieinsätze zur Bekämpfung von Aufständen der vorangegangenen Jahre retrospektiv analysierte und daraus Handlungsempfehlungen für die Zukunft ableitete. Dabei thematisiert er schon zu Beginn seines Beitrags das im Mittelpunkt der damaligen Polizeiarbeit stehende, wegen seiner immanenten Widersprüche kaum lösbare Problem, einerseits eine der neuen demokratischen Staatsform angemessene und für die effektive Bekämpfung der allgemeinen Kriminalität erforderliche, starke Bürgerorientierung aufzuweisen, andererseits aber auch über eine hohe militärische Schlagkraft zur Bekämpfung der zahlreichen gewaltsamen Aufstände gegen die Regierung verfügen zu müssen. „Die ganze politische und soziale Lage in Deutschland drängt also darauf hin, der Schutzpolizei ihre Hauptaufgabe als Truppenpolizei des polizeilichen Masseneinsatzes noch auf Jahre hinaus zu erhalten. Wenn wir die Erfahrungen des Polizeieinsatzes im vergangenen Jahr nun polizeitechnisch auswerten, so geschieht dies […] um die Berufs- 947 Vgl. H. Schützinger, Neue Wege der Schutzpolizei, in: ZDPol, 20. Jg. (1923/24), Nr. 19 (5.1.1924), S. 307ff., Nr. 20 (20.1.1924), S. 330ff., Nr. 21 (5.2.1924), S. 350ff. IV. Die deutsche Polizei in der Zwischenkriegszeit 246 auffassung des Schutzpolizeibeamten und -führers zu vertiefen, den Einsatz der Truppenpolizei von unfruchtbaren militärischen Schlacken zu reinigen und so zu gestalten, daß unter voller Wahrung der Festigkeit, Disziplin und Verwendbarkeit des Polizeikörpers der Führer alle polizeilichen Hilfsmittel bis zum Äußersten, dem Gebrauch der Schußwaffe, erschöpft und sich bei seinem Handeln leiten läßt von sozialem Verständnis und doch von der eisenharten Willenskraft, die Autorität des Staates, dessen Verfassung und Gesetzen er Geltung zu verschaffen hat, zu wahren. Dazu gehört eine Vereinigung der polizeilichen Spezialkenntnisse des alten Polizeioffiziers der Einzeldienstpolizei mit denen der Befehlstechnik und der Truppenführung des ehemaligen Armeeoffiziers und der gefühlsmäßig zu erfassenden, taktvollen Einstellung als verantwortungsbewußter Staatsbürger im neuen Staat.“948 Die widersprüchlichen Anforderungen an die Weimarer Polizei und die Schwierigkeiten, die erforderlichen polizeilichen Aufgaben und Kompetenzen miteinander in Einklang zu bringen, zeigten sich bei Hermann Schützinger sehr anschaulich. So wollte er die Polizei von unnötigen militärischen Elementen „reinigen“, betonte aber gleichzeitig die erforderliche „Disziplin“ und die „eisenharte[n] Willenskraft“. Benötigt wurden das „soziale[m] Verständnis“ und die Bürgernähe des „alten Polizeioffiziers“, aber ebenso die militärische Kompetenz des kriegserfahrenen, kampferprobten „Armeeoffiziers“. Genauso wichtig sei aber auch eine der Republik angemessene staatsbürgerliche Haltung. Gerade durch diese direkte Gegenüberstellung der entsprechenden Argumente zeigte der Autor, dass er sich zwar der enormen, damit zusammenhängenden Probleme bewusst war, aber gleichwohl eine einseitige Ausrichtung an einer der angesprochenen Dimensionen ablehnte und einen integrativen, gleichermaßen militärische wie auch zivile Aspekte umfassenden Ansatz der Polizeiarbeit anstrebte. Wie die folgenden Ausführungen verdeutlichten, vertrat er dabei die Ansicht, dass gerade diese Integration die Polizei flexibler einsetzbar machte, und sie so in die Lage versetzen könnte, Unruhen und Aufstände im Innern zielgenauer und damit auch effektiver als das Militär zu bekämpfen. „Der militärische Einsatz geht in starren Formen vor sich. […] Wie ein Uhrwerk läuft die gewaltige Maschine ab. […] Das muß unter den gegebenen Umständen so sein; denn die Wehrmacht als ‚ultima ratio‘ des 948 Schützinger, Neue Wege der Schutzpolizei (5.1.1924), S. 308. 1. Zusammenbruch und Neuaufbau (1918-23) 247 Staates ist bestimmt, zu handeln in der Stunde der höchsten innerpolitischen Gefahr lediglich nach militärtaktischen Gesichtspunkten. Vom Polizeieinsatz aber verlangt man mehr: Die Schutzpolizei soll im Rahmen der staatlichen Gemeinschaft nach innerpolitisch fein nüancierten [sic] Gesichtspunkten der politischen Leitung zum Einsatz gebracht werden können – und mit aller Schärfe und Kraft, wenn es die Lage erfordert. […] Er muß sich anpassungsfähig an die verschiedenen Stadien der Massenerregung erweisen, er muß jederzeit ‚unsichtbar‘ gemacht und ‚abgestoppt‘ werden können. Er muß ein biegsames und geschmeidiges Instrument in den Händen der politischen Leitung darstellen.“949 Sehr aufschlussreich waren dann seine folgenden Ausführungen, in denen er auf die in den ersten Jahren der Weimarer Republik stattgefundenen, polizeilichen Großeinsätze zur Bekämpfung von Aufständen einging und dabei kritisierte, dass die militärische Orientierung der Polizei seiner Einschätzung nach zu stark ausgeprägt gewesen sei. Besonders deutlich wurde er bei seiner Analyse der polizeilichen Bekämpfung des Mitteldeutschen Aufstandes von 1921, die er mit einer Schärfe und Deutlichkeit kritisierte, die erstaunlich war und aufzeigte, dass die Weimarer Polizei – zumindest nach einer dreijährigen ‚Bedenkzeit‘ – durchaus zu Selbstkritik fähig und auch bereit war, aus Fehlern der Vergangenheit zu lernen. Seine Kritik setzte schon bei der Formulierung des Auftrages durch das preußische Innenministerium an, die seiner Meinung nach zu stark von militärischen Gesichtspunkten geleitet war und daher nicht nur den eigentlichen Zweck eines Polizeieinsatzes verfehlte, sondern zudem das Potenzial der Polizei nicht ausschöpfte. „Der polizeitaktische Zweck der Aktion […] war zweifellos die Lokalisierung und Auslöschung der Aufstandsbewegung. Wenn auch die Zentralleitung der K.P.D. bewußt den Brand im Mansfelder Gebirgskreis schürte, so mußten doch alle polizeilichen Maßnahmen erschöpft werden, den Brand unblutig einzudämmen und zu ersticken. Die Folge des polizeilich – wollen wir sagen – anfechtbaren Einsatzes der beiden Schutzpolizeiabteilungen war der Ausbruch des mitteldeutschen Aufruhrs […].“950 949 Schützinger, Neue Wege der Schutzpolizei (5.1.1924), S. 309. 950 Schützinger, Neue Wege der Schutzpolizei (5.1.1924), S. 309. IV. Die deutsche Polizei in der Zwischenkriegszeit 248 Hervorzuheben ist hier vor allem der letzte Satz, in dem Hermann Schützinger ziemlich deutlich feststellte, dass der Mitteldeutsche Aufstand seiner Meinung nach die Folge eines verfehlten Polizeieinsatzes war und dass dementsprechend das preußische Innenministerium und die Polizeiführung eine erhebliche (Teil-) Schuld am Ausbruch und am gewaltsamen Verlauf dieser Unruhen trugen. Die Tatsache, dass ein solcher Vorwurf Anfang des Jahres 1924 durch einen Polizeioberst in einem der wichtigsten Publikationsorgane der Polizei publiziert werden konnte, ist selbst aus heutiger Sicht bemerkenswert und muss sicherlich als Ausdruck einer erstaunlich fortschrittlichen, sehr offenen Fehlerkultur interpretiert werden. Der Autor fuhr mit seiner Kritik dann sogar noch fort und stellte auch die Zweckmäßigkeit der weiteren Durchführung des Polizeieinsatzes in Frage, der seiner Meinung nach durch ein unnötig hohes Maß an polizeilicher Gewalt geprägt war – u. a. durch den Einsatz von Artillerie – und daher zu viele Menschenleben kostete. „Gegen eine kräftige Rollsalve der zugeteilten Reichswehrbatterie zur moralischen Erschütterung der Aufständischen ist auch nicht das mindeste einzuwenden. Dann aber mußten Verhandlungen einsetzen. Der Zweck der Schutzpolizei ist nicht, durch Sturmangriffe – die nebenbei dem Angreifer keine, dem Verteidiger aber 70 Tote eingebracht haben – äußerliche Erfolge zu erringen, sondern aufrührerische Volksgenossen mit einem Minimum von Opfern unter die Gesetze zu zwingen.“951 Gerade im Vergleich zu den oben erörterten, zweieinhalb Jahre früher ebenfalls in dieser Zeitschrift publizierten ‚Lobeshymnen‘ des preußischen Innenministeriums auf den Polizeieinsatz zur Bekämpfung des Mitteldeutschen Aufstands952 wird deutlich, wie stark die Ansichten eines in der Hierarchie der Polizei weit oben angesiedelten Polizeiobersts wie Hermann Schützinger von denen des preußischen Innenministeriums abweichen konnten – und dementsprechend wie heterogen die Institution Polizei in der damaligen Zeit war, und wie schwierig es daher ist, generelle und zugleich belastbare Aussagen über diese Institution und ihre Rolle als Instrument staatlicher Herrschaft in der Weimarer Republik zu machen. Hermann Schützinger war jedenfalls davon überzeugt, dass die Weimarer Po- 951 Schützinger, Neue Wege der Schutzpolizei (5.1.1924), S. 309. 952 Vgl. o. V., Darstellung der Bekämpfung des Aufruhrs (20.4.1921), S. 31ff.; o. V., Erfahrungen und Bemerkungen aus der Bekämpfung des Aufruhrs (5.5.1921), S. 60ff. 1. Zusammenbruch und Neuaufbau (1918-23) 249 lizei diese Funktion bei der Bekämpfung von Aufständen unter den damaligen Bedingungen grundsätzlich sehr gut erfüllen konnte – allerdings nur unter der Voraussetzung, dass sie nicht zweckentfremdet, einseitig an militärischen Maßgaben orientiert eingesetzt wurde, sondern möglichst gewaltlos und dabei unmissverständlich klarstellend, dass sie als Instrument der demokratisch legitimierten Regierung handelte. „Dieser Schutzpolizeieinsatz muß völlig den Charakter einer friedlichen Aktion bewahren und darf erst nach Einverständnis der Verwaltungsbehörden und nach gründlicher Aufklärung der Belegschaften großer Werke durch Regierungsbeamte erfolgen. […] Vorbedingung für die leidenschaftslose und möglichst unblutige Niederbeugung eines Linksputsches ist ein Vertrauensverhältnis zwischen der Landespolizei und den Arbeitermassen, das in der Zuversicht gipfelt, daß die Erhaltung der demokratischen Republik oberstes Handlungsgesetz der staatlichen Exekutive darstellt.“953 Das sich darin ausdrückende, klare Bekenntnis eines führenden Polizeibeamten zu Beginn des Jahres 1924 für eine bürgernahe, demokratischen Werten verpflichtete, allen Bevölkerungsschichten gleichermaßen dienende Polizei ließ sich nicht nur vereinzelt, sondern durchaus regelmäßig in den in der ZDPol in den ersten Jahren der Republik publizierten Beiträgen nachweisen. Insofern erscheint es angebracht, dies nicht als Einzelmeinung, sondern durchaus als bedeutsame ‚Strömung‘ in der Polizei in den Anfangsjahren der Weimarer Republik zu werten. Gleichwohl lässt sich angesichts der Art und Weise, wie die Polizei in den Anfangsjahren der Weimarer Republik bei der Bekämpfung der oben erörterten, vom linksextremen politischen Lager ausgehenden Aufstände vorging, insgesamt festhalten, dass diese ‚Strömung‘ – zumindest bis zum Jahresende 1923 – offensichtlich keinen entscheidenden Einfluss auf die polizeiliche Praxis nahm. Betrachtet man das tatsächliche Handeln der Polizeibeamten – d. h. die polizeiliche Praxis – bei der Bewältigung dieser polizeilichen Großlagen, dann lässt sich keine substanzielle Demilitarisierung der inneren Sicherheit in dieser Zeit nachweisen. Vielmehr behielt die Polizei einen stark ausgeprägten militärischen Charakter und stellte dies mit ihrem martialischen Vorgehen bei der Bekämpfung von Aufständen immer wieder eindrucksvoll unter Beweis. Dies konnte nicht ohne Auswirkungen auf das Ansehen und die gesellschaftliche Akzeptanz nicht nur der für die Bewältigung von Großlagen zuständigen, kasernierten Schutzpoli- 953 Schützinger, Neue Wege der Schutzpolizei (20.1.1924), S. 331 f. IV. Die deutsche Polizei in der Zwischenkriegszeit 250 zeieinheiten, sondern auch der Polizei im Allgemeinen bleiben. Gerade in den unteren Bevölkerungsschichten und im Arbeitermilieu dürfte die Bereitschaft zur freiwilligen Unterstützung der Polizei, auf die Streifen- und Kriminalbeamte in besonderem Maße angewiesen waren, unter dem an militärischen Einsatztaktiken orientierten Vorgehen der Schutzpolizei bei der Bewältigung von Großlagen gelitten haben. Immerhin zeigte sich bei der Niederschlagung des Hitler-Putsches am 9. November 1923, der im ‚Kugelhagel‘ der bayerischen Polizei endete und 16 Putschisten das Leben kostete954, dass die von der Polizei präferierten, militärisch geprägten, auf Schusswaffeneinsatz basierenden Einsatztaktiken nicht nur gegen linksextreme Aufständische, sondern auch gegen rechtsextreme Putschisten erfolgreich zum Einsatz kamen. Dieses Vorgehen der Polizei erwies sich in den hier betrachteten, turbulenten, von einem hohen Maß an politischer Gewalt geprägten Anfangsjahren der Weimarer Republik als effektive Strategie bei der Bekämpfung von Aufständen. Trotz der zweifellos dadurch verursachten Entfremdung zwischen der Polizei und den unteren Bevölkerungsschichten, der im Zusammenhang mit dem oben erörterten Akzeptanzdefiziten des polizeilichen Streifendienstes zu sehen ist, muss man zu dem Ergebnis kommen, dass es zumindest kurzfristig zur Sicherung der staatlichen Herrschaft beitrug. Modernisierung, Demokratisierung und Professionalisierung (1924-29) Wie bereits oben angemerkt worden ist, gelten die Jahre zwischen 1924 und 1929 insbesondere aufgrund des deutlichen Rückgangs der politischen Gewalt und einer relativen ökonomischen Stabilisierung als die ‚ruhigen‘ Jahre der Weimarer Republik. Diese Stabilisierung betraf auch die institutionelle Entwicklung der Weimarer Polizei, die in den Jahren zuvor mit der Einrichtung einer im Wesentlichen aus Schutz- und Kriminalpolizei bestehenden Einheitspolizei eine Organisationsform gefunden hatte, die bis zur nationalsozialistischen Machtübernahme Anfang 1933 nahezu unverändert Bestand haben sollte.955 Aus diesem Grund und wegen des vergleichsweise geringen Ausmaßes an politischer Gewalt sind gerade die sechs relativ stabilen, ‚ruhigen‘ Jahre zwischen 1924 und 1929 nach Ansicht von Richard Bessel „am besten“ geeignet, um „[d]ie Frage, wie die 2. 954 Vgl. Mommsen, Adolf Hitler ß, S. 33ff.; Sturm, Weimarer Republik, S. 34 f. 955 Vgl. Buder, Die Reorganisation der preußischen Polizei, S. 443ff.; Leßmann- Faust, Die Preußische Schutzpolizei, S. 88ff. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 251 Polizei der Weimarer Republik zu charakterisieren sei, [… zu …] beantworten“956. Stabilisierung bedeutet in diesem Zusammenhang aber keinesfalls, dass die institutionelle und funktionale Entwicklung der deutschen Polizei in dieser Zeit ruhte. Vielmehr verlagerte sich in dieser Konsolidierungsphase der Entwicklungsfokus von den Organisationsstrukturen auf die Organisationsmitglieder, d. h. die Polizeibeamten, und die Organisationsprozesse, d. h. die praktische Polizeiarbeit. In den Mittelpunkt rückten damit Maßnahmen und Entwicklungen, die auf eine zunehmende Demokratisierung, Modernisierung und Professionalisierung sowohl der Polizei als auch der Polizeiarbeit abzielten. Technisch-wissenschaftliche Innovationen Die Modernisierung der Weimarer Polizei spiegelte sich zunächst in der wachsenden Bereitschaft zur Nutzung von moderner Technik für polizeiliche Zwecke wider.957 Wie die zahlreichen, Mitte der 1920er Jahre in der ZDPol erschienenen Beiträge belegten, die sich mit Einführung von verschiedenen technischen Innovationen in der deutschen Polizei beschäftigten, wurde der technische Fortschritt angesichts der offensichtlichen Chancen für eine Optimierung der Polizeiarbeit zumindest von den technikaffinen Teilen der Polizei zunächst mit einer enormen Begeisterung aufgenommen. Dabei wurden nicht nur die Vorzüge von technischen Innovationen dargestellt, sondern auch die Risiken, die sich bei einer verspäteten oder gar unterlassenen Einführung für den Erfolg polizeilicher Maßnahmen und die Sicherheit der Bevölkerung ergeben konnten. Typisch hierfür waren die beiden folgenden Einstiege in zwei Publikationen, die im Juni 1925 von zwei Diplom-Ingenieuren in der ZDPol veröffentlicht wurden. So begann der von H. Rumm publizierten Aufsatz, der sich mit den Möglichkeiten des technischen Fernsehens für die Polizei auseinandersetzte, folgendermaßen: „‚Baustein an Baustein fügt die Zeit.‘ – Die Entwicklung der Wissenschaft und Technik geht mit Riesenschritten vorwärts. Kaum hat eine neue sensationelle Erfindung die Gemüter erregt, kommt aus aller Herren Länder Schlag auf Schlag wieder etwas Neues. Was uns heute noch unmöglich erscheint, vielleicht ist es morgen schon Wirklichkeit a) 956 Bessel, Militarisierung und Modernisierung, S. 331. 957 Vgl. Knatz, Polizei in der Weimarer Republik, S. 52 f. IV. Die deutsche Polizei in der Zwischenkriegszeit 252 geworden! […] Neuheiten aufzunehmen, um technisch auf der Höhe zu sein, ist heute für jede Arbeitsrichtung unbedingte Notwendigkeit geworden. So darf auch die Kriminalistik nicht zurückstehen, neue Verfahren auf ihr Arbeitsfeld zu übertragen, um damit der Menschheit zu dienen und dem [sic] Verbrechertum zu steuern.“958 Noch stärker betonte P. Heine in den Anfangssätzen seines im gleichen Heft veröffentlichten Beitrags über eine im Juni 1925 in Karlsruhe stattgefundene Internationale Polizeitechnische Ausstellung, dass sich die deutsche Polizei den Herausforderungen des technischen Fortschrittes stellen und die sich daraus ergebenden Möglichkeiten nutzen musste: „Ein Volk steht bekanntlich auf einer umso höheren Entwicklungsstufe, je größer seine technischen Errungenschaften sind und je besser es diese für sich auszunutzen versteht. Die Technik, ohne die ein moderner Staat überhaupt nicht denkbar ist, spielt deshalb im Kulturleben eines Volkes die wichtigste Rolle. […] Aber auch die unsauberen Elemente eines Staates haben es verstanden, für sich die Technik nutzbar zu machen und sie überall da anzuwenden, wo es für sie von Vorteil ist […]. Soll nun der Kampf gegen das Verbrecherhandwerk von der Polizei mit Erfolg geführt werden, so ist es unerläßlich, daß dieser alle diejenigen technischen Hilfsmittel zur Verfügung gestellt werden, die zur Bekämpfung des Verbrecherunwesens in Betracht kommen.“959 Auch wenn beide hier zitierten Passagen ziemlich pathetisch formuliert waren und insbesondere P. Heines überschwängliche Einschätzung der Bedeutung der Technik für das Kulturleben in den 1920er Jahren durchaus angezweifelt werden kann, so spiegelten sie doch sicherlich auch den Fortschrittsglauben und die Technikbegeisterung wider, die während der ‚Goldenen Zwanziger‘ – wenn auch in geringerem Ausmaß als im Rahmen der ‚Roaring Twenties‘ in den USA960 – in großen Teilen der deutschen Bevölkerung verbreitet waren.961 Rückschlüsse darauf, ob diese Begeisterung auch unter Polizeibeamten verbreitet war, lassen sich daraus aber nicht ziehen. Die Tatsache, dass die Autoren dieser beiden Beiträge als Diplom-In- 958 H. Rumm, Das technische Fernsehen, in: ZDPol, 22. Jg. (1925), Nr. 5 (5.6.1925), S. 136. 959 P. Heine, Die Technik auf dem Gebiete des Polizeiwesens, in: ZDPol, 22. Jg. (1925), Nr. 5 (5.6.1915), S. 162. 960 Vgl. R. P. Carlisle, Handbook of Life in America: The Roaring Twenties: 1920 to 1929, New York 2009, S. 119ff. 961 Vgl. z. B. Kolb, Deutschland, S. 137ff. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 253 genieure eine höhere akademisch-technische Ausbildung erfahren hatten und daher ganz offensichtlich keine ‚klassischen‘ Polizeibeamten waren, spricht tendenziell gegen diese Annahme. Sehr überzeugend wirkt hingegen der Hinweis von P. Heine, dass sich die Polizei allein schon deswegen nicht dem technischen Fortschritt versperren durfte, weil das ‚Verbrechertum‘ die neuen technischen Möglichkeiten auch nutzen würde und damit gegenüber der Polizei im Vorteil sei. Die Einführung von neuen technischen Hilfsmitteln wäre demzufolge weniger das Ergebnis proaktiven polizeilichen Handelns mit dem Ziel, die Vorzüge der neuartigen technischen Möglichkeiten zu nutzen, gewesen als die Folge externer Entwicklungen in der Gesellschaft, denen sich die Polizei nicht entziehen konnte. Dieses letztgenannte Argument ist umso plausibler, als es bis zum heutigen Tag ein zentraler Treiber der technischen Modernisierung in der Polizei geblieben ist.962 Gleichwohl ist insgesamt davon auszugehen, dass auch die besonderen, von Fortschrittsglauben und Technikbegeisterung geprägten Rahmenbedingungen der ‚Goldenen Zwanziger‘ Jahre nicht spurlos an der der Weimarer Polizei vorbeigegangen sein und den externen Druck zur Übernahme von technischen Innovationen weiter verstärkt haben dürften. Die technische Modernisierung der Polizei Mitte der 1920er Jahre betraf im schutzpolizeilichen Bereich vor allem die Nutzung von nachrichtentechnischen Innovationen sowie die flächendeckende Anschaffung von Kraftwagen bzw. ihre Übernahme aus Beständen der Reichswehr, die den Aktionsradius der Polizeikräfte massiv erweiterte und zugleich ihre Reaktionsgeschwindigkeit deutlich erhöhte.963 Diese Einschätzung spiegelt sich auch in einem Aufsatz über die technischen Hilfsmittel der Berliner Polizei wider, der im April 1926 in der ZDPol publiziert wurde.964 Darin stellte der damalige Polizeivizepräsident von Berlin und spätere (1946-1951) stellvertretende Oberbürgermeister Groß-Berlins bzw. dann West-Berlins Ferdinand Friedensburg nach einer kurzen Erläuterung der hohen Arbeitsbelastung der Berliner Polizei insbesondere aufgrund des gestiegenen 962 Vgl. H.-J. Lange, V. Mittendorf, Innere Sicherheit und Technik – Die Bedeutung technologischer Adaptationen im Hinblick auf Spezialisierung und Aufgabenwandel der Polizei, in: G. Simonis, R. Martinsen, T. Saretzki [Hrsg.], Politik und Technik: Analysen zum Verhältnis von technologischem, politischem und staatlichem Wandel am Anfang des 21. Jahrhunderts, Politische Vierteljahresschrift, 41. Jg. (2000), Sonderheft 31, Wiesbaden 2001, S. 268ff. 963 Vgl. Bessel, Policing, S. 197ff.; Bessel, Militarisierung und Modernisierung, S. 327. 964 Vgl. F. Friedensburg, Technische Hilfsmittel der Berliner Polizei, in: ZDPol, 23. Jg. (1926), Nr. 8 (20.4.1926), S. 175ff. IV. Die deutsche Polizei in der Zwischenkriegszeit 254 Verkehrsaufkommen und der Aktivitäten des organisierten Verbrechertums fest: „Da unter den gegebenen Voraussetzungen, insbesondere infolge des Friedensvertrages und der Finanznot des Staates eine irgendwie wesentliche Vermehrung der Schutzpolizei auf absehbare Zeit nicht in Frage kommt, muß angestrebt werden, Erfüllung [sic] der polizeilichen Aufgaben durch höchstmögliche Ausnutzung des gegebenen Beamtenmaterials zu verwirklichen. […] Das der Leitung der Polizei hierbei gestellte Problem läßt sich kurz dahin zusammenfassen, daß die begrenzte Beamtenzahl durch stärkste Steigerung der technischen Hilfsmittel 1. untereinander mit allen Teilen des zu schützenden Gebietes in enger Nachrichtenverbindung stehen muß, 2. unter Anwendung einer möglichst hohen Beförderungsgeschwindigkeit beweglich gemacht wird, um raschestens an Ort und Stelle erscheinen und dort raschestens die erforderlichen Erfolge erzielen zu können.“965 Bemerkenswert ist die relativ ausführliche Begründung der Notwendigkeit und Zweckmäßigkeit der Einführung von modernen technischen Hilfsmitteln, die sich darin zeigt, dass der Autor ca. 25% seines Beitrags diesem Thema widmet. Dies deutet darauf hin, dass die der Polizei von den politischen Entscheidungsträgern zur Verfügung gestellten Ressourcen auch im Frühjahr 1926 – d. h. mehr als sechs Jahre nach Kriegsende und mitten in den ‚Goldenen Zwanzigern‘ – sehr knapp waren, so dass Investitionsausgaben einer guten und stichhaltigen Begründung bedurften. Das größte Potenzial wurde wohl insbesondere in der Nachrichten- und der Kraftfahrzeugtechnik gesehen, da die damit verbundene Optimierung der Reichweite und der Kommunikation zwischen Polizeibeamten an zentralen Problemfeldern der damaligen Polizeiarbeit ansetzten und besonders hohe Erfolgsbeiträge erwarten ließen. Die Ausführungen von Ferdinand Friedensburg bezogen sich zwar auf die Metropole Berlin, die sich wegen ihrer Funktion als Hauptstadt, internationale Metropole und dichtbesiedelter Ballungsraum deutlich vom Rest des Deutschen Reiches unterschied. Allerdings ist davon auszugehen, dass diese Einschätzung für die Polizei in weniger urbanen Räumen, die in der Regel noch größere Territorien abdecken mussten, erst recht zutreffend gewesen sein dürften. 965 Friedensburg, Technische Hilfsmittel der Berliner Polizei (20.4.1926), S. 175. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 255 Ein typisches Beispiel für die Implementierung von nachrichtentechnischen Innovationen in der Weimarer Polizei war die Inbetriebnahme der deutschlandweit ersten und europaweit zweiten Polizeimeldeanlage in Berlin, von der in einem ca. neunseitigen, mit zahlreichen Fotografien und technischen Skizzen illustrierten, im Juli 1924 und Januar 1925 in zwei Teilen in der ZDPol veröffentlichten Artikel des promovierten Leiters der Telegraphenverwaltung des Polizeipräsidiums Berlin, W. H. Tramm, berichtet wird.966 Die Notwendigkeit bzw. den erwarteten Nutzen dieser technischen Innovation beschrieb er folgendermaßen: „Die Nützlichkeit solcher Anlagen hat man in Amerika allgemein erkannt. Viele große Städte Nord- und Südamerikas, sowie auch eine ganze Reihe kleiner Städte, speziell der Vereinigten Staaten, sind schon längere Zeit im Besitz solcher Einrichtungen. […] In Deutschland haben erst die nach dem Kriege so stark veränderten Sicherheitszustände das Bedürfnis aufkommen lassen, die im Außendienst tätigen Beamten mit ihren Dienststellen in innigeren Kontakt zu bringen, d. h. eine bessere Ausnutzung des Exekutivpersonals zu erlangen und damit auch eine Personalersparnis zu verbinden. […] Die nachfolgende Beschreibung wird erkennen lassen, daß die Anlage nicht nur in der augenblicklich noch nicht voll befriedeten, sondern auch in normaler Zeit der Polizei und damit auch den Einwohnern Berlins gute Dienste leisten wird.“967 Neben dem Eingeständnis, dass die Polizei des ehemaligen Kriegsgegners USA den deutschen Sicherheitskräften nachrichtentechnisch offensichtlich weit voraus ist, fällt insbesondere auf, dass der Autor bei der Rechtfertigung der Anschaffung der Polizeimeldeanlage nicht nur auf die verbesserte Sicherheitslage aufgrund der erleichterten Kommunikation, sondern – wie im oben angeführten Beitrag von Ferdinand Friedensburg – auch auf Effizienzsteigerungen sowie Kostenersparnisse verwies. Auch im weiteren Verlauf des Beitrags wurde mehrere Male auf die Kostendimension dieser technischen Innovation verwiesen, was die finanziellen Restriktionen der Weimarer Polizei Mitte der 1920er Jahre verdeutlichte. Der weitaus überwiegende Teil der Ausführungen enthielt aber – den Zielen einer polizeilichen 966 Vgl. W. H. Tramm, Die Polizeimeldeanlage des Polizeiamtsbezirkes ‚Berlin-Mitte‘, in: ZDPol, 21. Jg. (1924/25), Nr. 7 (5.7.1924), S. 155ff., Nr. 19 (5.1.1925), S. 486ff. 967 Tramm, Die Polizeimeldeanlage des Polizeiamtsbezirkes ‚Berlin-Mitte‘ (5.7.1924), S. 155. IV. Die deutsche Polizei in der Zwischenkriegszeit 256 Fachzeitschrift entsprechend – eine ausführliche Erläuterung der Funktionsweise dieses für die Polizeibeamtenschaft völlig neuartigen Instruments und des Umgangs damit. Am Ende des Beitrags wurde dann auch auf die Schwächen dieser Anlage eingegangen, nämlich ihre noch begrenzten Einsatzmöglichkeiten: „Freilich wirken sich im Augenblick diese geschilderten Vorzüge noch nicht in vollem Umfange aus, weil der ausgebaute Bezirk zu klein ist. […] Sollte es gelingen, auch Privatpersonen in irgend einer Form die Mitbenutzung der Meldeanlage zu ermöglichen, so wird auch die Wirtschaftlichkeit einer solchen Anlage sich zweifellos einmal nachweisen lassen. Zusammenfassend kann deshalb wohl gesagt werden, daß eine moderne Polizeimeldeanlage für eine Großstadt wir Berlin von derartig weittragender Bedeutung ist, daß es sehr zu begrüßen wäre, wenn der baldige Ausbau über ganz Groß-Berlin erfolgen würde.“968 Neben dem erneuten Hinweis auf die Notwendigkeit, Wirtschaftlichkeitsaspekte zu berücksichtigen und die ökonomische Zweckmäßigkeit dieser technischen Innovation auch konkret zu belegen, wurde die zu geringe Anzahl an Meldeanlagen und potenziellen Nutzern dieser neuen Technologie als zentrale Schwachstelle angeführt. In dieser Problemformulierung bzw. in der von W. H. Tramm geforderten und in den folgenden Jahren dann auch tatsächlich rasch umgesetzten Problemlösung – den quantitativen Ausbau solcher Anlagen – ist einer der Grundgedanken der modernen Netzwerktheorie enthalten, der unter der Bezeichnung ‚Netzwerkeffekte‘ bzw. ‚Netzwerkexternalitäten‘ bis heute bei der Einführung von Innovationen in Bereich der Informations- und Kommunikationstechnik eine zentrale Rolle spielt, nämlich die Tatsache, dass der Nutzen einer nachrichtentechnischen Innovation in der Regel umso höher ist, je mehr Akteure sich daran beteiligen.969 Dass die Einführung von technischen Innovationen im Allgemeinen und nachrichtentechnischen im Besonderen in der Polizei nicht immer reibungslos funktionierte und durchaus mit Risiken behaftet war, zeigte ein weiterer Artikel zu Polizeimeldeanlagen, der im Juni 1925 968 Tramm, Die Polizeimeldeanlage des Polizeiamtsbezirkes ‚Berlin-Mitte‘ (5.1.1925), S. 487 f. 969 Vgl. M. L. Katz, C. Shapiro, Product Compatibility Choice in a Market with Technological Progress, in: Oxford Economic Papers, 38. Jg. (1986), Supplement: Strategic Behaviour and Industrial Competition, S. 146. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 257 in der ZDPol erschien.970 Der namentlich nicht genannte Autor nahm Bezug auf einen Artikel, der kurz zuvor in einer anderen Fachzeitschrift erschienen war und solchen Anlagen einen hohen Nutzen zubilligte, um dem dann entschieden zu widersprechen: „Reine Polizeimeldeanlagen, d. h. Anlagen mit Polizeimeldern auf der Straße, die lediglich polizeilichen Zwecken dienen, nützen dem Publikum nur mittelbar. Dem Publikum Schlüssel zu den Straßenmeldern zu verabfolgen, hat sich nicht bewährt. In Rio de Janeiro, wo ein solcher Versuch gemacht wurde, mußten diese Schlüssel alsbald wieder eingezogen werden. Einen wirklichen Nutzen von Polizeimeldeanlagen hat das Publikum nur dann, wenn die Melder mit Notrufanlagen kombiniert werden, d. h. wenn dem Publikum gestattet wird, sich mittelst Privatmeldern anzuschließen. Da die Unterhaltung solcher Anlagen kostspielig ist, müssen allerdings für solche Notrufmelder oder Privatmelder Gebühren erhoben werden. […] Die z. Zt. in Berlin bestehende Versuchs-Polizeimeldeanlage hat sich dieser Form nicht bewährt. Sie soll daher umgebaut werden und es soll der Weiterausbau der Polizeimeldeanlage in Groß-Berlin nach den bisher gesammelten Erfahrungen erfolgen. Der Ausbau, mit dem alsbald begonnen werden soll, erfolgt als kombinierte Anlage, d. h. als Polizeimelde- und Notrufanlage, so daß dem Publikum der Anschluß gegen geringe Gebühren gestattet ist.“971 Wie diese Aussagen zeigten, bewahrheiteten sich die weiter oben dargestellten, von W. H. Tramm angesprochenen Defizite von Polizeimeldeanlagen anscheinend innerhalb weniger Monate und führten zu einem vorläufigen Scheitern der polizeilichen Nutzbarmachung dieser neuen Technologie. Gleichwohl führte dies nicht zu einer Rückkehr in den früheren Stand, sondern zu einer Modifikation und Funktionserweiterung dieser Anlagen, die einen weiteren, schnellen quantitativen Ausbau ermöglichen sollte. Interessant war aber auch hier der Hinweis auf die zu berücksichtigenden Kostenaspekte, die erneut auf die knappen finanziellen Mittel der öffentlichen Hand für Investitionen in neue Technologien hinwiesen und denen man durch die Erhebung von Gebühren begegnen wollte. Bereits ein Jahr später stellte der Ministerialbeamte und spätere Leiter der Polizeischule für Technik und Verkehr Heinrich Paetsch in einem im September 970 Vgl. o. V., Polizeimeldeanlage, in: ZDPol, 22. Jg. (1925), Nr. 5 (5.6.1925), S. 162. 971 o. V., Polizeimeldeanlage (5.6.1925), S. 162. IV. Die deutsche Polizei in der Zwischenkriegszeit 258 1926 in der ZDPol erschienenen Beitrag in Bezug auf den Entwicklungsstand dieser neuen Technologie fest: „In den deutschen Großstädten werden drei Arten [von Polizeimeldeanlagen] verwendet: reine Hilferufanlagen, die von den Privatwohnungen zum Überfallkommando führen, reine Polizeimeldeanlagen, d. h. die Polizeibeamten sind in der Lage, von Straßenmeldern einer Zentrale mechanische Zeichen zu übermitteln oder mit ihr telephonisch in Verbindung zu treten. Schließlich ist eine Vermischung beider Systeme z. B. in Preußen dergestalt durchgeführt worden, daß besonders leistungsfähigen Firmen die Einrichtung einer derartigen Anlage übertragen wird mit der Maßgabe, daß sie die Gesamtkosten übernehmen und sich verpflichten müssen, auf eine bestimmte Zahl von Privatanschlüssen je einen öffentlichen Melder aufzustellen.“972 Zwei Jahre nach der Inbetriebnahme der deutschlandweit ersten Polizeimeldeanlage in Berlin hatte sich diese Innovation offensichtlich derart bewährt, dass sie nun in allen oder zumindest zahlreichen Großstädten genutzt werden konnte. Dabei belegten die rasche Weiterentwicklung dieser Technologie, die sich in der Existenz und der Nutzung von verschiedenen Formen von Meldeanlagen widerspiegelte, aber auch der kreative gewählte Ansatz zur Überwindung der finanziellen Restriktionen – nämlich die Abwälzung der Investitionskosten auf private Unternehmen im Sinne der heutigen Public-Private-Partnerships973 – die bemerkenswerte Dynamik des technischen Fortschritts in den mittleren Jahren der Weimarer Republik sowie den davon ausgehenden Entwicklungsdruck auf die Polizei. Insgesamt verdeutlicht dieses Beispiel aus dem Bereich der Nachrichtentechnik, dass die technische Modernisierung der Polizei Mitte der 1920er Jahre keine Option war, die sie ausschlagen konnte, sondern vielmehr eine enorme Herausforderung, der sie sich stellen musste, um ihre Funktion als Instrument staatlicher Herrschaft erfolgreich ausüben zu können. Unverzichtbar war hierbei aber auch die zweite oben genannte, zentrale Dimension der technischen Modernisierung der Polizei, nämlich die flächendeckende Ausstattung der Polizei mit Kraftfahrzeugen. Ferdinand Friedensburg stellte in seinem bereits oben zitierten, im April 1926 veröf- 972 H. Paetsch, Polizeitechnik – Die polizeiliche Nachrichtenübermittlung im Draht und Äther, in: ZDPol, 23. Jg. (1926), Nr. 18 (20.9.1926), S. 508. 973 Vgl. G. Ambrosius, Die Entwicklung Öffentlich-Privater Partnerschaften seit den 1980er Jahren, die fördernden und die hindernden Faktoren, in: dms – der moderne staat, 6. Jg. (2013), Nr. 2, S. 321ff. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 259 fentlichten Artikel über die technischen Hilfsmittel der Berliner Polizei nach seinen Ausführungen zu nachrichtentechnischen Innovationen in der Berliner Polizei diesbezüglich fest: „Der raschen Anrufmöglichkeit hat dann die rasche Beweglichkeit der Polizei zu entsprechen. Das Pferd, bis zum Kriege immerhin nicht unwichtiges Mittel, um Polizeibeamte rasch an bedrohte Stellen zu bringen oder um größere Gebiete verhältnismäßig rasch polizeilich überwachen zu lassen, hat diese Rolle ausgespielt. […] Immer mehr drängt sich das Kraftfahrzeug in den Vordergrund, zumal mit Rücksicht auf die riesenhaften Ausmaße des Großberliner Dienstbezirks. […] Diese Entfernungen bedeuten Schwierigkeiten, die nur das Kraftfahrzeug innerhalb der zulässigen Zeit überwinden kann. So verfügt die Berliner Polizei zurzeit über einen Park von 76 Personenkraftwagen; der Bestand ist im raschen Wachsen begriffen.“974 Anders als bei der Behandlung von anderen technischen Innovationen fand man in diesem Beitrag wie auch in anderen Artikeln keinerlei Hinweise auf mögliche Schwachstellen des Einsatzes von Kraftfahrzeugen oder auf die erheblichen damit verbundenen Kosten, sondern stattdessen pauschale Hinweise auf die Unverzichtbarkeit dieses Instruments. Ein typisches Beispiel hierfür ist der im Januar 1928 in der ZDPol erschienene Aufsatz von Herbert Schmidt über den Einsatz von Kraftwagen bei der Polizei, der mit dem folgenden Satz begann: „Der moderne Polizeidienst ist ohne die Verwendung des Kraftwagens undenkbar.“975 Anschließend folgten in diesem Beitrag zahlreiche Hinweise und Erläuterungen in Bezug auf die vielfältigen Einsatzmöglichkeiten von Kraftfahrzeugen durch die Polizei und die gewaltigen, kaum angemessen zu würdigenden Vorteile, die sich daraus für die Polizeiarbeit und die öffentliche Sicherheit ergaben. So verwies Ferdinand Friedensburg im April 1926 insbesondere auf die deutlichen Zeitersparnisse bei der Beförderung von leitenden Beamten, Brand- und Mordkommissionen, Überfallkommandos und geschlossenen Einheiten der Bereitschaftspolizei sowie auf den Einsatz von Panzerwagen, die allein schon aufgrund ihrer abschreckenden Wirkung sehr wirksam bei der Niederschlagung von Unruhen und Aufständen 974 Friedensburg, Technische Hilfsmittel der Berliner Polizei (20.4.1926), S. 176. 975 H. Schmidt, Der Kraftwagen bei der Polizei, in: ZDPol, 25. Jg. (1928), Nr. 1 (5.1.1928), S. 25. IV. Die deutsche Polizei in der Zwischenkriegszeit 260 seien.976 Heinrich Paetsch ergänzte diese in seinem im September 1926 erschienenen Beitrag noch um den Einsatz von Motorrädern für den Verkehrskontrolldienst und die schnelle Übermittlung von Nachrichten, bevor er schließlich die „stärkste Waffe der Polizei […], ein mit 2 Maschinengewehren ausgerüstetes Panzerauto“977 anführte. Ferdinand Friedensburg erwähnte zudem mit dem motorisierten Streifendienst eine damals noch wohl noch unübliche Einsatzmöglichkeit für Kraftfahrzeuge: „Für den Patrouillendienst, namentlich in den Außenbezirken, ist jetzt versuchsweise bei einigen Revieren in den dünn bevölkerten Vororten ein Kraftwagendienst eingerichtet, der die regelmäßige Abpatrouillierung der Straßen mit einem geringen Beamtenaufwand ermöglicht. Soweit die bisherige kurze Zeit der Erprobung einen Schluß zulässt, ist die günstige Einwirkung auf die Sicherheit des betreffenden Bezirkes in einem auffälligen Rückgang der Einbruchsziffern immerhin angedeutet. Wenn möglich, sollen die meisten der 162 Berliner Reviere in ähnlicher Weise mit kleinen Kraftwagen ausgestattet werden.“978 Diese Art des Streifendienstes gewann in der Folgezeit dann aber rasch an Bedeutung, so dass Heinrich Paetsch in seinem im April 1928 in der ZD- Pol erschienenen Beitrag den Streifenwagen als „üblich“ und als „wichtigstes Fahrzeug der Polizei in ruhigen Zeiten“979 bezeichnete, und auch heutzutage gilt der motorisierte Streifendienst – jetzt in Form des so genannten ‚Funkstreifendienstes‘ – als „Rückgrat“980 des beruflichen Alltags im schutzpolizeilichen Bereich. Insgesamt betrachtet lässt sich festhalten, dass in den mittleren Jahren der Weimarer Republik eine sehr umfassende Motorisierung der Polizei stattfand. Den Entwicklungsstand der Kraftfahrzeugtechnik in der deutschen Polizei im Jahr 1928 fasst Heinrich Paetsch folgendermaßen zusammen: „Heute ist das Kraftfahrzeug ein selbstverständlicher Ausrüstungsgegenstand bei der Polizei geworden. Täglich fahren die Streifenwagen durch die Großstädte, fast allsonntäglich verwenden die großstädti- 976 Vgl. Friedensburg, Technische Hilfsmittel der Berliner Polizei (20.4.1926), S. 176 f. 977 H. Paetsch, Polizeitechnik – Das Polizeikraftfahrwesen, in: ZDPol, 23. Jg. (1926), Nr. 18 (20.9.1926), S. 507. 978 Friedensburg, Technische Hilfsmittel der Berliner Polizei (20.4.1926), S. 176. 979 H. Paetsch, Verkehr und Technik bei der Polizei in 25 Jahren, in: ZDPol, 25. Jg. (1928), Nr. 7 (10.4.1928), S. 248. 980 T. Feltes, Polizeiliches Alltagshandeln, Effektivität und Bürgernähe: Anmerkungen zu alten Problemen, in: Polizeispiegel, 29. Jg. (1994), Nr. 6, S. 145. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 261 schen Polizeien, besonders die Berliner Polizei, den gesamten Kraftwagenpark, um bei den zahllosen Demonstrationen und sonstigen Veranstaltungen die Beamten schnell auf den Platz ihrer Diensttätigkeit zu bringen, ihnen hierdurch den Dienst erleichternd und die Zahl der Beamten gewissermaßen verdoppelnd. Der Kraftwagen bei der Polizei ist auch dem Publikum so selbstverständlich geworden, wie man sich eine moderne Feuerwehr ohne seine Verwendung nicht mehr vorstellen kann.“981 Interessanterweise wurde in den eben genannten Beiträgen bei der Begründung der Zweckmäßigkeit des Einsatzes von Kraftwagen für den Streifendienst nicht wie in den anderen, weiter oben aufgeführten Beiträgen zu nachrichtentechnischen Innovationen hauptsächlich auf die Ressourcenoder Kosteneffizienz zurückgegriffen („mit einem geringen Beamtenaufwand“), sondern vor allem mit angeblich positiven Auswirkungen auf die Sicherheitslage argumentiert. So verwies Ferdinand Friedensburg auf „einem auffälligen Rückgang der Einbruchsziffern“982 nach der Einführung des motorisierten Streifendienstes, ohne konkrete Zahlen oder Belege anzugeben. Deutlich mutiger war diesbezüglich Herbert Schmidt, der in seinem Anfang 1928 publizierten Beitrag den Rückgang der Kriminalität aufgrund des Einsatzes von Kraftwagen sogar auf 40% quantifizierte, ohne allerdings irgendeinen Hinweis darauf zu geben, wie er diese Zahl ermittelt hatte.983 Die geringe Glaubwürdigkeit dieser Aussage wurde in diesem Aufsatz kurz darauf noch einmal besonders deutlich, als der Autor, dessen berufliche Stellung oder Funktion in der Zeitschrift zwar nicht genannt wurde, der aber immerhin promoviert war, zunächst feststellte, dass es „in Europa heute kein Land mehr [gibt], in dem nicht die Polizei durchweg mit Kraftwagen der verschiedensten Arten ausgestattet wäre“, um sich nur zwei Sätze später selbst zu widersprechen, indem er anmerkt, dass „z. B. in Frankreich und Russland, wo die Verwendung des Kraftwagens noch nicht allgemein bei der Polizei geworden ist, eine bemerkenswerte Erhöhung der Kriminalität zu verzeichnen ist“984. Diese Einschätzungen sind allerdings angesichts der mittlerweile vorliegenden, durchaus belastbaren Forschungsergebnisse, die keinen Einfluss von motorisierten Polizeistreifen 981 Paetsch, Verkehr und Technik bei der Polizei in 25 Jahren (10.4.1928), S. 248. 982 Friedensburg, Technische Hilfsmittel der Berliner Polizei (20.4.1926), S. 176. 983 Vgl. Schmidt, Der Kraftwagen bei der Polizei (5.1.1928), S. 25. 984 Schmidt, Der Kraftwagen bei der Polizei (5.1.1928), S. 25. IV. Die deutsche Polizei in der Zwischenkriegszeit 262 auf die Kriminalität in der betreffenden Region feststellen985, äußerst fragwürdig. Die Schwierigkeiten, die Effizienz bzw. Wirtschaftlichkeit der Nutzung von Kraftfahrzeugen in der Polizei zu erbringen, sprach Heinrich Paetsch konkret in seinem im April 1926 erschienenen Aufsatz an: „Die Schwierigkeiten für eine zweckmäßige Organisation des polizeilichen Kraftfahrwesens bestehen darin, daß es sich nicht um einen fahrplanmäßig sich abwickelnden Verkehrsbetrieb handelt, sondern daß bald zu dieser, bald zu jener Zeit geringere oder größere Polizeikräfte schnell an besondere Gefahrenpunkte geführt werden müssen. Es handelt sich also um einen typischen Wartebetrieb, der der Natur der Sache nach nicht wirtschaftlich arbeiten kann, der aber doch so organisiert werden muß, daß eintretendenfalls der gesamte Organismus in schnellste Bewegung gesetzt wird, während er oft stunden-, ja tagelang unbenutzt steht. Besonders in großen Polizeiverwaltungen ist es daher nicht leicht, unter Beachtung größter Sparsamkeit einen allen Anforderungen gerecht werdenden Betrieb gut zu organisieren.“986 Auch wenn seine Einschätzung, dass die Organisation des Einsatz von Kraftfahrzeugen in der Polizei und der Nachweis ihrer Wirtschaftlichkeit sehr anspruchsvoll und schwierig ist, zutraf, so war doch seine Behauptung, dass der polizeiliche Fuhrpark „der Natur der Sache nach nicht wirtschaftlich arbeiten kann“, zweifelsohne betriebswirtschaftlicher Unsinn. Selbstverständlich kann auch bei Investitionen in Geräte, die – wie beispielsweise Schusswaffen, Fotoapparate oder Polizeimeldeanlagen – nicht permanent, sondern nur zeitweise verwendet werden, eine Wirtschaftlichkeitsanalyse auf der Grundlage von Kosten-Nutzen-Abwägungen erfolgen. Aber selbst wenn man annimmt, dass die Weimarer Polizei oder zumindest der Autor nicht über die notwendige fachliche Kompetenz verfügten, um eine solche Analyse durchzuführen987, so würde dies auch für nahezu alle Investitionen der Polizei im technische Geräte gelten, was das angeführte Argument ad absurdum führt. 985 Vgl. G. L. Kelling, T. Pate, D. Dieckman, C. E. Brown, The Kansas City Preventive Patrol Experiment – A Summary Report, Washington 1974, https://w ww.ncjrs.gov/pdffiles1/Digitization/ 42537NCJRS.pdf (Zugriff: 26.1.2018), S. 1ff.; T. Feltes, Effizienz der Straftatenbekämpfung, in: M. Kniesel, E. Kube, M. Murck [Hrsg.], Handbuch für Führungskräfte der Polizei – Wissenschaft und Praxis, Lübeck 1996, S. 587. 986 Paetsch, Polizeitechnik – Das Polizeikraftfahrwesen (20.9.1926), S. 506. 987 Zur Geschichte der Kosten-Nutzen-Analyse vgl. N. Hanley, C. L. Spash, Costbenefit analysis and the environment, Aldershot 1993, S. 4ff. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 263 Angesichts der offensichtlichen Mängel in den Argumentationen von Ferdinand Friedensburg, Herbert Schmidt und Heinrich Paetsch erscheint es naheliegend anzunehmen, dass sie an einer transparenten und belastbaren Wirtschaftlichkeitsanalyse, die möglicherweise zu dem Ergebnis gekommen wäre, dass z. B. Investitionen in das polizeiliche Aus- und Fortbildungswesen wirtschaftlicher als die Anschaffung von Kraftfahrzeugen waren, nicht interessiert waren. Vielmehr entsteht der Eindruck, dass die Autoren den Einsatz von Kraftfahrzeugen für polizeiliche Zwecke als eine so enorme Bereicherung und Erleichterung der Polizeiarbeit empfanden, dass sie sich eine Polizei ohne Kraftfahrzeuge kaum vorzustellen vermochten und dementsprechend einen weiteren quantitativen Ausbau der Ausstattung mit Polizeifahrzeugen für sehr wünschenswert und zweckmä- ßig hielten. Herbert Schmidt formulierte dieses Ziel am Ende seines Beitrages auch ganz explizit: „Man muß daher an die zuständigen Staats- und Reichsverwaltungsbehörden den dringenden Wunsch richten, daß die Verwendung des Kraftwagens im Polizeidienst noch weiter und schneller als bisher ausgebaut werden muß.“988 Anders als bei anderen technischen Innovationen, bei denen die Polizei – wie oben für den nachrichtentechnischen Bereich gezeigt worden ist – durchaus die Notwendigkeit einsah, ihre Zweckmäßigkeit und Effizienz nachzuweisen, war der Wunsch nach dem flächendeckenden Einsatz von Kraftfahrzeugen für polizeiliche Zwecke wohl so stark ausgeprägt, dass man ihn offensichtlich unabhängig davon realisieren wollte, ob es gelang, die Wirtschaftlichkeit bzw. Effizienz dieses technischen Hilfsmittels auch tatsächlich zu belegen. Die oben angeführten Begründungen der Notwendigkeit von polizeilichen Kraftfahrzeugen könnten also im Sinne des dramaturgischen Ansatzes der Polizeisoziologie, demzufolge ein Großteil der Polizeiarbeit ein ‚Schwindel‘ bzw. ‚Theater‘ ist989, durchaus als Versuch der Polizei interpretiert werden, ihr Publikum – hier insbesondere die politischen Entscheidungsträger sowie die Bevölkerung – zu manipulieren, um unter dem ‚Deckmantel‘ einer angeblichen Verringerung der Kriminalität Investitionen in technische Hilfsmittel tätigen zu können, die möglicherweise hauptsächlich der Ausweitung der Autonomie, des Prestiges und der Bequemlichkeit ihrer Berufsangehörigen dienten und nur geringfügig zu 988 Schmidt, Der Kraftwagen bei der Polizei (5.1.1928), S. 26. 989 Vgl. Manning, The police, S. 194. IV. Die deutsche Polizei in der Zwischenkriegszeit 264 einer verbesserten Sicherheitslage beitrugen.990 Dass sich der Einsatz von Kraftfahrzeugen letztlich positiv auf den Erfolg der Polizei bei der Kriminalitätsbekämpfung und der Sicherung der öffentlichen Ordnung ausgewirkt haben dürfte, soll dabei gar nicht in Abrede gestellt werden, allerdings deuten die Beiträge in der ZDPol darauf hin, dass bei der technischen Modernisierung der Polizei Mitte der 1920er Jahre auch die Durchsetzung der partikularen Interessen der Polizei und ihrer Berufsangehörigen eine wichtige Rolle spielten. Die zunehmende Implementierung von technisch-wissenschaftlichen Innovationen in den mittleren Jahren der Weimarer Republik betraf auch den kriminalpolizeilichen Bereich. Hier kam es – ganz im Gegensatz zur Schutzpolizei – zu einer zunehmend engeren Zusammenarbeit mit Universitäten und Forschungseinrichtungen, um auf diese Weise wissenschaftliche Erkenntnisse zur Verbesserung ihrer Ermittlungsmethoden und Arbeitsmittel zu nutzen.991 Hierzu gehörte das in der damaligen kriminalistischen Praxis wohl wichtigste kriminaltechnische Verfahren – die Daktyloskopie – allerdings nicht, da es bereits vor 1918 einen so hohen Entwicklungsstand aufwies, dass man es in der Weimarer Zeit trotz seiner praktischen Bedeutung wohl nicht mehr als Innovation bezeichnen konnte.992 Eine herausragende Rolle in der deutschen Kriminaltechnik dieser Zeit spielte die 1912 gegründete, im Berliner Polizeipräsidium angesiedelte Abteilung für gerichtliche Chemie und naturwissenschaftliche Kriminalistik der Preußischen Landesanstalt für Chemie, die deutschlandweit das einzige ausschließlich der Kriminalpolizei zuarbeitende Labor war.993 Der Leiter dieser Institution, der Chemie-Professor August Brüning, veröffentlichte im Juni 1925 in der ZDPol einen relativ umfassenden Überblick über den damaligen Stand der naturwissenschaftlichen Kriminalistik.994 Darin erörterte er vor allen die polizeirelevanten aktuellen Entwicklungen in den Bereichen Chemie und Mikroskopie, die der Kriminalpolizei zahlreiche neue, sehr nützliche Ermittlungsansätze boten, beispielsweise durch die Analyse von Blut, Kot, Samen, Haaren, Fingernägeln oder Stofffasern bei Tötungs- oder Sexualdelikten oder durch die Untersuchung von Schussverletzungen mit Ziel, die dabei verwendete Waffen zu identifizieren. Beson- 990 Vgl. Manning, Police Work, S. 119ff.; Manning, The police, S. 203ff. 991 Vgl. Knatz, Polizei in der Weimarer Republik, S. 52. 992 Vgl. Wagner, Volksgemeinschaft ohne Verbrecher, S. 98ff. 993 Vgl. Wagner, Volksgemeinschaft ohne Verbrecher, S. 97 f. 994 Vgl. A. Brüning, Die Aufgaben des Naturwissenschaftlers in der modernen Kriminalistik, in: ZDPol, 22. Jg. (1925), Nr. 5 (5.6.1925), S. 129ff. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 265 ders aufschlussreich ist allerdings der vom Autor gewählte Einstieg in diesen Beitrag, in dem er zunächst auf die Bedeutung der Nutzung von neuen naturwissenschaftlichen Methoden durch die Polizei, vor allem aber auf die Rolle, die dem Polizeibeamten bzw. Kriminalisten dabei zufiel, einging. „Die Zunft der Verbrecher hat sich in der neuesten Zeit entschieden gehoben […], die Zeit daß der Verbrecher mit derselben Axt die Haustür und den Schädel seines Opfers einschlug und dann das Mordwerkzeug gewissermaßen als Besuchskarte am Tatort hinterließ, dürfte endgültig vorbei sein. Der moderne Kriminalist sucht nach kleineren Indizien und hat gelernt, die feinen Hilfsmittel der Naturwissenschaften zur Überführung des Täters auszunutzen. Hierbei geht ihm dann der in diesen Disziplinen ausgebildete Sachverständige zur Hand. Aber es muß schon gleich hier vorausgeschickt werden: Der Kriminalist, der einen Tatort untersucht oder einen Fall bearbeitet, muß die modernen Untersuchungsmethoden wenigstens in groben Umrissen kennen, denn sonst kann er nicht die wichtigsten Verwahrstücke auffinden und sicherstellen, die der Sachverständige zur Untersuchung benötigt.“995 Hier zeigte sich ein zentrales Problem bei der Nutzung von neuen wissenschaftlichen Erkenntnissen durch die Kriminalpolizei, das bis heute kaum an Relevanz verloren hat. Zwar war seiner Einschätzung nach der Einsatz von modernen, auf höchstem wissenschaftlichem Niveau stehenden kriminaltechnischen Verfahren durch die Polizei allein schon deshalb erforderlich, weil auch Kriminelle sich diesbezüglich weiterentwickelt hatten, allerdings waren diese Verfahren in ihrer Anwendung oftmals so kompliziert, dass ein normaler Polizeibeamter, der in der Regel keine umfassende wissenschaftliche Ausbildung erhalten hatte, damit überfordert war. Damit diese bei polizeilichen Ermittlungen sinnvoll eingesetzt werden konnten, war zum einen eine Zusammenarbeit mit entsprechend ausgebildeten Wissenschaftlern unerlässlich, zum anderen erforderte es auch ein gewisses Maß an spezialisiertem, wissenschaftlichem Fachwissen des Kriminalisten, das diesen erst in die Lage versetzt, mit dem betreffenden Wissenschaftler zusammenzuarbeiten. Was dies für die Personalauswahl im kriminalpolizeilichen Bereich, aber auch für die Aus- und Fortbildung bedeutete, thematisierte der Staatsanwalt Wilhelm Kajdacsy in einem Aufsatz mit dem Titel „Die Kriminalpoli- 995 Brüning, Die Aufgaben des Naturwissenschaftlers in der modernen Kriminalistik (5.6.1925), S. 129. IV. Die deutsche Polizei in der Zwischenkriegszeit 266 zei von heute“, den er im Februar 1925 in der ZDPol veröffentlichte.996 In diesem Beitrag beschäftigte er sich zunächst mit einer kürzlich aufgeklärten Mordserie in Hannover, deren Aufklärung wohl sehr langwierig war, so dass in den Medien deutliche Kritik an der Arbeit der Kriminalpolizei ge- äußert wurde. Anschließend erörterte er auf einer allgemeinen Ebene die Leistungsfähigkeit der deutschen Kriminalpolizei. „Unser Stolz war bisher die Großstadtpolizei. Die größere Schlagkraft dieser Behörde gegenüber den Kriminalbehörden in mittleren und kleinen Städten beruhte darauf, daß aus einem großen Beamtenstande nur die bestbefähigten Beamten für die Kriminalpolizei ausgesucht wurden. Diese hatten ständigen methodischen Dienstunterricht. Bei der großen Zahl der Kriminalbeamten konnte man Spezialisten ausbilden. Daneben wurden alle Hilfsmittel der Kriminaltechnik, insbesondere die Daktyloskopie und Photographie ausgenutzt. […] Das Hauptmoment für die Herausbildung eines leistungsfähigen Beamtenstandes waren aber nicht Geldausgaben, sondern eine straffe Dienstaufsicht und eine ständige wissenschaftliche und technische Schulung der einzelnen Beamten, auch der älteren und im Dienste bereits erfahrenen. […] In dieser Aufwärtsbewegung der Leistungen trat nach dem staatlichen Umsturz ein starker Rückgang ein. Es fehlte an geeigneten Beamten, um diese Arbeitsweise wie bisher durchzuführen, auch fehlte es an Geldmitteln. Erst allmählich ist darin wieder eine Wendung zum Besseren eingetreten, aber es ist noch nicht der Zustand der Leistungsfähigkeit wieder erreicht worden, der vor dem Kriege bestanden hat.“997 An der Deutlichkeit der hier geäußerten Kritik erkennt man, dass der Autor als Staatsanwalt nicht der Polizei angehörte und daher wenig Rücksicht auf die Befindlichkeiten dieser Berufsangehörigen nehmen musste. Die Vorstellung, dass ein Polizei- oder erst recht ein Kriminalbeamter in der Öffentlichkeit die Ansicht vertrat, die deutsche Kriminalpolizei des Jahres 1925 sei leistungsschwächer als diejenige des Jahre 1914, erscheint ziemlich abwegig. Gleichwohl dürfte gerade die Staatsanwaltschaft, die täglich mit den Ergebnissen kriminalpolizeilicher Ermittlungen konfrontiert war, besonders gut in der Lage gewesen sein, ihre Leistungsfähigkeit einzuschätzen, so dass man von einer relativ hohen Glaubwürdigkeit der oben angeführten Bewertung ausgehen kann. Die eigentliche Kernaussage war aller- 996 W. Kajdacsy, Von der Kriminalpolizei von heute, in: ZDPol, 21. Jg. (1924/25), Nr. 22 (20.2.1925), S. 577ff. 997 Kajdacsy, Von der Kriminalpolizei von heute (20.2.1925), S. 577 f. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 267 dings die Begründung dieser Leistungsdefizite, die seiner Meinung nach weniger in der Finanzmittelknappheit der öffentlichen Hand als in der geringeren Fachkompetenz der Kriminalisten lag. Das Aufgabenfeld der Kriminalpolizei galt – und gilt – nicht zuletzt wegen der Notwendigkeit der Nutzung von moderner Kriminaltechnik als äußerst anspruchsvoll und setzte entsprechend hohe intellektuelle und fachliche Kompetenzen der Kriminalbeamten voraus. Dies erforderte, dass man einerseits bereits bei der Personalauswahl auf diese Kompetenzen achtete, dass man Kriminalisten aber andererseits auch ein geeignetes Aus- und Fortbildungswesen zur Verfügung stellte, das es ihnen ermöglichte, zumindest ansatzweise auf dem aktuellen Stand des wissenschaftlich-technischen Fortschritts in den kriminalistisch relevanten Forschungsfeldern zu bleiben. Dass die Beschaffung solchen Personals und die Implementierung von entsprechend kosten- und zeitintensiven Aus- und Fortbildungssystemen von großen öffentlichen Organisation wie der Polizei nur schwer zu bewerkstelligen und unter den schwierigen ökonomischen und fiskalischen Rahmenbedingungen der Weimarer Republik geradezu unmöglich gewesen sein dürfte, ist offensichtlich.998 Die Realität bei der Auswahl von Kriminalbeamten schilderte Wilhelm Kajdacsy weiter unten in seinem Beitrag folgendermaßen: „Früher wurden zur Kriminalpolizei nur diejenigen abgeordnet, die sich nach ihrer Vorbildung und nach ihrer geistigen Befähigung als die Besten erwiesen hatten. Dies geschah aus der Erkenntnis heraus, daß der Kriminaldienst von allen Zweigen der Polizeitätigkeit die größten Anforderungen an die geistigen und moralischen Eigenschaften der Beamten stellte. Heute bildet der Ersatz in den Kriminalabteilungen eine schwere Sorge, und man überweist den Kriminalabteilungen zum Teil Beamte, die an anderen Stellen der Polizei infolge vorgerückten Alters oder aus sonstigen Gründen nicht mehr verwendbar sind. Diese Beamten haben für den Kriminaldienst in der Regel nicht mehr die nötige Elastizität und Anpassungsfähigkeit und bringen mitunter ihrem neuen Dienst nicht das Interesse entgegen, das verlangt werden muß.“999 Neben dem Hinweis auf die aus fachlicher Sicht wenig zielführende, aber aus organisatorischer und beamtenrechtlicher Sicht durchaus nachvollziehbare und daher auch heute noch übliche Rekrutierungspraxis, auf Schutzpolizeibeamte zurückzugreifen, die den physischen Anforderungen des 998 Vgl. Wagner, Volksgemeinschaft ohne Verbrecher, S. 127ff. 999 Kajdacsy, Von der Kriminalpolizei von heute (20.2.1925), S. 578. IV. Die deutsche Polizei in der Zwischenkriegszeit 268 Streifendienstes nicht mehr gewachsen sind, war aber vor allem August Brünings erneuter, sehr deutlicher Hinweis auf die hohe „geistige Befähigung“ sowie „Elastizität und Plastizität“, die ein Kriminalist aufweisen sollte, um seine Aufgaben zufriedenstellend erfüllen zu können, bemerkenswert. Auch wenn an dieser Stelle kein expliziter Hinweis auf die Kriminaltechnik erfolgte, so ergab sich doch aus dem Gesamtkontext und der oben zitierten Passage, dass dieses unter den schwierigen ökonomischen Rahmenbedingungen der Weimarer Republik praktisch unerfüllbare Anforderungsprofil für Kriminalisten insbesondere auf den rasanten technisch-wissenschaftlichen Fortschritt zurückzuführen war, der sowohl das Kriminalitätsgeschehen als auch das kriminaltechnische Instrumentarium entscheidend beeinflusste. Die offensichtliche, wenn auch praktisch kaum umsetzbare Lösung für diese Problematik, nämlich eine Erhöhung der der Kriminalpolizei zur Verfügung stehenden finanziellen und personellen Ressourcen, sprach Wilhelm Kajdacsy allerdings nicht in der Deutlichkeit an, mit der er seine Kritik an der Leistungsfähigkeit der Kriminalpolizei formulierte. So wies er zwar u. a. darauf hin, dass es seit dem Kriegsende an finanziellen Mitteln für die Kriminalpolizei fehle, dass die Vergütung von Kriminalbeamten unbefriedigend und ihre technische Ausstattung unzureichend sei, allerdings merkte er dann wiederum in nicht nachvollziehbarer Weise an, dass „[g]roße Mittel […] für die Kriminalpolizei nicht erforderlich [sind]“1000. Die Widersprüchlichkeit seiner Argumentation wurde schließlich im letzten Absatz seines Beitrags noch einmal besonders deutlich, als er festhielt: „Alle diese Mängel zu beheben ist ohne erhebliche Kosten möglich, wenn sich die Erkenntnis durchringt, daß solche Ausgaben nützlich angewandt worden sind, um die Leistungen der Kriminalpolizei zu heben und damit der Allgemeinheit eine bessere Sicherheit zu schaffen, als sie zur Zeit besteht.“1001 Diese Aussage war in sich unschlüssig und unlogisch, da der Autor im ersten Teilsatz zunächst eine erhebliche Kostenerhöhung ausschloss, um dann anschließend eben diese Kostenerhöhung zu rechtfertigen. Damit stand dieser logische Widerspruch stellvertretend für die sich durch den ganzen Beitrag ziehende Ambiguität in Bezug auf die ökonomischen Ursachen für die von ihm konstatierten Leistungsdefizite der Kriminalpolizei, die vermutlich darauf zurückzuführen war, dass sich der Autor darüber in Klaren 1000 Kajdacsy, Von der Kriminalpolizei von heute (20.2.1925), S. 578. 1001 Kajdacsy, Von der Kriminalpolizei von heute (20.2.1925), S. 579. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 269 war, dass eine Erhöhung der finanziellen und personellen Ressourcen der Kriminalpolizei zwar fachlich geboten, aber angesichts der „staatlichen Dauerfinanzkrise“1002 in der Weimarer Republik mehr als unwahrscheinlich war. Insofern ist davon auszugehen, dass die ungenügende finanzielle Ausstattung der Kriminalpolizei, die weiter oben ja auch für den schutzpolizeilichen Bereich konstatiert worden ist, zweifelsohne ein erhebliches Hindernis bei der technischen Modernisierung der Polizei in der Weimarer Zeit darstellte. In diesem Sinne betont auch Patrick Wagner die Notwendigkeit, das in den 1920er Jahren stark gestiegene Potenzial naturwissenschaftlicher Kriminalistik nicht mit der aufgrund von mangelnden Ressourcen eher seltenen Nutzung dieser innovativen Möglichkeiten im polizeilichen Alltag zu verwechseln.1003 Spezialisierung und Zentralisierung Eine wichtige Rolle bei der Modernisierung und Professionalisierung der Polizei spielten aber auch neue Erkenntnisse auf dem Gebiet der Organisations- und der Verwaltungswissenschaften, die mit arbeitsorganisatorischen Innovationen einhergingen.1004 Sie basierten im Wesentlichen auf Max Webers bürokratischem Ansatz, Henri Fayols administrativem Ansatz und Frederick W. Taylors arbeitswissenschaftlichem Ansatz und zielten auf eine Optimierung der organisationalen Strukturen und Prozesse mit dem Ziel einer effizienteren Aufgabenerfüllung ab.1005 Die Übertragung der Grundgedanken dieser organisationswissenschaftlichen Ansätze auf die Polizei führte zu einer zunehmenden Differenzierung bzw. Spezialisierung sowie Zentralisierung der Polizeiarbeit, die gerade im kriminalpolizeilichen Bereich besonders stark ausgeprägt stattfand und die Kriminalpolizei in dieser Zeit „zu einem der, im bürokratischen Sinne, fortschrittlichsten Zweige der staatlichen Verwaltung überhaupt“1006 machte.1007 Eine frühe, relativ ausführliche Auseinandersetzung mit den betreffenden arbeitsorganisatorischen Innovationen und ihren Einsatzmöglichkeib) 1002 Wagner, Volksgemeinschaft ohne Verbrecher, S. 129. 1003 Vgl. Wagner, Volksgemeinschaft ohne Verbrecher, S. 97 f. 1004 Vgl. S. Spieker, Passer à l’Acte: Policing (in) the Office – Notes on Industry Standards and the Große Polizeiausstellung of 1926, in: K. Mladek [Hrsg.], Police Forces – A Cultural History of the Police, New York u. a. 2007, S. 148ff. 1005 Vgl. Schreyögg, Organisation, S. 31ff. 1006 Leßmann-Faust, Weimarer Republik, S. 37. 1007 Vgl. Wagner, Volksgemeinschaft ohne Verbrecher, S. 79ff. IV. Die deutsche Polizei in der Zwischenkriegszeit 270 ten in der Polizei war der im September 1925 von Herbert Peucker, promovierter Regierungsrat im preußischen Innenministerium, in der ZDPol veröffentlichte Beitrag mit dem Titel „Versuch einer Lehre von der polizeilichen Organisationspraxis“.1008 Gleich zu Beginn nahm der Autor explizit Bezug auf den oben angesprochenen, in der Literatur auch als ‚Taylorismus‘ bezeichneten arbeitswissenschaftlichen Ansatz: „Im Jahre 1906 überraschte der amerikanische Forscher Fred W. Taylor die Wirtschaftskreise mit seinem Werk ‚Shop Management‘, in Deutschland erschienen unter dem Titel ‚Die Betriebsleitung‘. In diesem Buch wies Taylor nach, daß man die Vorgänge des industriellen Arbeitsprozesses genau so methodisch untersuchen könne wie andere rein wissenschaftliche Probleme. In den folgenden Jahren ist dann die Betriebswissenschaft immer mehr durchforscht worden und umfaßt heute nicht nur das Studium der industriellen Erzeugnisse, der Werkzeuge und Arbeitsbehelfe, sondern auch die Organisation der Arbeit, die Psychotechnik und den Taylorismus im engeren Sinne. Während man aber in der Nutzanwendung dieser so gewonnenen Lehren auf rein fabrikatorischem Gebiete bei uns (nicht in Amerika) lange Zeit aus hier nicht zu erörternde Gründen sehr zurückhaltend war, hatte man sie in den Büros der kaufmännischen und industriellen Betriebe zur höchsten Blüte entwickelt, ja in den letzten Jahren, besonders nach dem Kriege, hatte sich hier schon eine gewisse Überorganisation herausgebildet. […] Während so auf dem Gebiete der Nutzanwendung der privatwirtschaftlichen Organisationslehre eine gewisse Rückbildung in manchen Betrieben nur förderlich sein könnte, tut es dringend not, in der Staatsverwaltung Versäumtes nachzuholen und auch hier eine allgemeine und besondere Lehre von der bestmöglichen Organisation herauszubilden.“1009 Dabei verdeutlichte der Autor seiner Leserschaft nicht nur die bemerkenswerte, theoretische und methodische Weiterentwicklung des Taylorismus, die maßgeblich zur Entstehung der Organisationstheorie bzw. -lehre als Teildisziplin der Betriebswirtschaftslehre führte, sondern vor allem seine erstaunlich schnelle Verbreitung in der Unternehmenspraxis – und zwar nicht nur in den USA, wo es entwickelt worden war und vor allem in den Produktionsbereichen der großen Industriekonzerne zum Standard wurde, 1008 H. Peucker, Versuch einer Lehre von der polizeilichen Organisationspraxis, in: ZDPol, 22. Jg. (1925), Nr. 12 (20.9.1925), S. 329ff. 1009 Peucker, Versuch einer Lehre (20.9.1925), S. 329. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 271 sondern auch in Deutschland. Innerhalb von weniger als 20 Jahren erreichte dieser Ansatz in der deutschen Industrie trotz des Ersten Weltkriegs und der sich daran anschließenden, äußerst turbulenten, von Mangelwirtschaft und Inflation geprägten ersten Krisenjahre der Weimarer Republik offensichtlich einen so hohen Entwicklungsstand, dass Herbert Peucker zumindest für den Büro- bzw. Verwaltungsbereich in privatwirtschaftlichen Unternehmen von einer unzweckmäßigen, kontraproduktiven „Überorganisation“ ausging. Gleichwohl stellte er auch fest, dass dies nicht für den öffentlichen Sektor und damit auch für Polizei galt, die in dieser Hinsicht noch einen erheblichen Nachholbedarf hatten und für die die oben angesprochenen, neuen arbeitsorganisatorischen Erkenntnisse sicherlich als innovativ gelten mussten. In seinem Beitrag versuchte der Autor dementsprechend, diese modernen Ansätze auf die Polizei zu übertragen. Dabei wählte er einen breiten Zugang, der über rein arbeitsorganisatorische Aspekte hinaus ging und auch die damit zusammenhängenden Anforderungen an die „leitenden Persönlichkeiten“ – d. h. das Top Management – der Polizei behandelte. Diese sollten insbesondere „einen gewissen Instinkt für Reibungsmöglichkeiten“ und einen „Verwaltungsinstinkt“ sowie gute Kenntnisse der Belegschaft, der örtlichen Verhältnisse und der polizeilichen Geschäftsgebiete haben und bei ihrem Führungshandeln „Wohlwollen nach unten hin, Rückgrat nach oben hin“ zeigen.1010 Den größten Teil des Beitrags widmete er dann der Anwendung von modernen arbeitsorganisatorischen Methoden in der Polizei.1011 Dabei orientierte er sich an neun ‚klassischen‘ Kerngedanken oder Prinzipien der Organisationslehre, die von der Entwicklung von standardisierten Stellenbeschreibungen über das Optimum- Prinzip und das Prinzip der horizontalen und vertikalen Gliederung der Verantwortlichkeit bis zur Anerkennung des Leistungsprinzips reichten und deren Berücksichtigung bei der Gestaltung der Strukturen und Prozesse in Polizeibehörden zu einer Optimierung der Organisation und einer effizienteren Aufgabenerfüllung führen sollte. Diese Prinzipien wurden nicht nur aufgeführt, sondern auch kurz erläutert, auf die konkrete Polizeiarbeit übertragen und meistens mit konkreten Beispielen veranschaulicht. Zudem wurden die damit verbundenen Vor- und Nachteile diskutiert sowie absehbare Umsetzungsschwierigkeiten angesprochen, so dass man durchaus den Eindruck gewinnen konnte, dass Herbert Peucker mit sei- 1010 Vgl. Peucker, Versuch einer Lehre (20.9.1925), S. 330 f. (Zitate: S. 330 und S. 331). 1011 Vgl. Peucker, Versuch einer Lehre (20.9.1925), S. 331ff. IV. Die deutsche Polizei in der Zwischenkriegszeit 272 nem Beitrag für die praktische Umsetzung dieser für die damalige Zeit innovativen Gedanken in der Polizei werben wollte. Im Gegensatz zu den weiter oben behandelten technisch-wissenschaftlichen Innovationen wurde bei der Erörterung dieser arbeitsorganisatorischen Neuerungen vor allem auf die damit erreichbaren Verbesserungen der Effizienz und der Qualität der Polizeiarbeit abgestellt, während Kostenargumente und die knappen finanziellen Ressourcen nahezu keine Rolle spielten. Dies ist angesichts des Rationalisierungspotenzials der angesprochenen arbeitsorganisatorischen Maßnahmen, der prekären Haushaltslage des Fiskus und der Tatsache, dass der Autor im preußischen Innenministerium beschäftigt war, so dass ihm die Haushaltslage nicht unbekannt sein konnte, durchaus erstaunlich. Und auch in den Schlusssätzen dieses Beitrags verzichtete Herbert Peucker auf einen Hinweis auf die mit moderner Arbeitsorganisation erzielbaren Kostensenkungen: „Wenn man so einmal die theoretischen Grundlagen der behördlichen Organisationspraxis aufzudecken versucht, dann sieht man auf der einen Seite, wieviel hier noch nachzuholen ist. Auf der anderen Seite muß festgestellt werden, daß in der Praxis die Schwierigkeiten, die in der Leitung eines großen Behördenapparates […] liegen, […] zum Teil nicht genügend erkannt, zum Teil unterschätzt werden. Gerade die Leiter der Behörden der Staatshoheitsverwaltung mit ihren vielen und oft dringenden politischen Aufgaben sind der Versuchung und oft der Notwendigkeit ausgesetzt, das Schwergewicht ihrer Tätigkeit zu sehr nach außen zu verlegen. Soweit sich dies in den immer noch unruhigen gegenwärtigen Zeiten nicht vermeiden läßt, muß der erste Mitarbeiter den Erfordernissen einer guten und einheitlichen Geschäftsorganisation nach innen Genüge verschaffen.“1012 Gerade diese letzten Sätze verdeutlichten, dass der Autor die arbeitsorganisatorischen Innovationen offensichtlich weniger als unmittelbar der Haushaltskonsolidierung dienendes Rationalisierungsinstrument, sondern vielmehr als Führungs- und Managementinstrument betrachtete, die von der Leitung einer Polizeibehörde genutzt werden konnten, damit diese besser funktionierte, und deren praktische Umsetzung nahezu kostenneutral möglich war und keine größeren Investitionen erforderte. Dass dadurch vermutlich Effizienzverbesserungen und möglicherweise auch Kostensenkungen erreicht werden würden, wurde zwar durchaus erwähnt, allerdings stand dies nicht im Mittelpunkt der Argumentation. Stattdessen lassen die 1012 Peucker, Versuch einer Lehre (20.9.1925), S. 333. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 273 Ausführungen darauf schließend, dass der Autor die Umsetzung von modernen arbeitsorganisatorischen Erkenntnissen in der Polizei nicht als instrumentelles, sondern als fundamentales Ziel betrachtete, das um seiner selbst willen verfolgt werden sollte.1013 Im kriminalpolizeilichen Bereich war die Diskussion um die Übernahme dieser arbeitsorganisatorischen Neuerungen sehr stark geprägt von der Frage, in welchem Ausmaß und in welcher Form eine Zentralisierung und Spezialisierung erforderlich war. Diese eindeutige Schwerpunktsetzung, die an eine schon in den ersten Nachkriegsjahren angestoßene, weiter oben bereits behandelte Diskussion in der ZDPol anknüpfte1014, ergab sich aus dem Umstand, dass die Kriminalpolizei in den mittleren Jahren der Weimarer Republik zweifelsohne stark dezentralisiert war, was offensichtlich von den meisten Experten als Defizit empfunden wurde. So merkte der damalige Chef der Berliner Kriminalpolizei und spätere Polizeivizepräsident Bernhard Weiß, ein promovierter Jurist jüdischer Abstammung1015, in einem im Januar 1925 in der ZDPol veröffentlichten Beitrag, in dem er seine Überlegungen zur anstehenden Reform der preußischen Kriminalpolizei vorstellte, in Bezug auf die Mängel der damaligen Kriminalpolizei an: „Der eine grundlegende Mangel: Es fehlt an einer einheitlichen kriminalpolizeilichen Organisation, die das ganze preußische Landesgebiet gleichmäßig und hinreichend kriminalpolizeilich versorgt. […] Da die Kommunen auf das Vorhandensein einer modernen Kriminalpolizei bald mehr, bald weniger Gewicht legen, ergibt sich eine Buntscheckigkeit der kriminalpolizeilichen Organisation und der kriminalpolizeilichen Tätigkeit, die mit den Anforderungen einer modernen Verbrecherbekämpfung unvereinbar ist […]. Ein weiterer Mangel der rein örtlich organisierten preußischen Kriminalpolizei ist die Ortsgebundenheit der Kriminalbeamten. […] Die Schäden dieses Zustandes liegen auf der Hand: der Verbrecher, insbesondere das gefährliche Gewohnheits- und Erwerbsverbrechertum, kehrt sich nicht an die Orts- 1013 Zur Unterscheidung von instrumentellen und fundamentalen Zielen vgl. F. Eisenführ, M. Weber, T. Langer, Rationales Entscheiden, 5. Aufl., Heidelberg u. a. 2010, S. 63ff. 1014 Vgl. insb. o. V., Die Polizei im Kampf mit dem Verbrechertum (15.1.1920), S. 529ff.; Glocker, Brauchen wir eine bewegliche Landeskriminalpolizei (24.6.1920), S. 149ff. 1015 Vgl. B. Weigel, Bernhard Weiß, in: W. Benz [Hrsg.], Handbuch des Antisemitismus – Judenfeindschaft in Geschichte und Gegenwart, Bd. 2: Personen, Berlin 2009, S. 880ff. IV. Die deutsche Polizei in der Zwischenkriegszeit 274 grenzen der kriminalpolizeilichen Zuständigkeit; beim Kampf zwischen dem ortgebundenen Kriminalbeamten und dem in Windeseile sein Tätigkeitsfeld wechselnden Schwerverbrecher zieht daher der Kriminalbeamte naturgemäß den kürzeren.“1016 Der Autor vertrat folglich die Ansicht, dass die Kriminalpolizei dem stark angewachsenen, zu einer enormen Gefährdung der öffentlichen Sicherheit herangewachsenen, spezialisierten „Erwerbsverbrechertum“ nicht gewachsen sei und dass nur eine weitgehend spezialisierte und zentralisierte Kriminalpolizei in der Lage sei, dieser Herausforderung erfolgreich zu begegnen. Mit dieser Problemanalyse, die fast wörtlich den bereits weiter oben erläuterten Ausführungen des Polizeiinspektors Glocker in derselben Zeitschrift im Jahr 1920 entsprach1017, stand Bernhard Weiß nicht alleine dar. Vielmehr konnte man in anderen Beiträgen eine Vielzahl von sehr ähnlichen Diagnosen finden. So kam beispielsweise der Staatsanwalt Wilhelm Kajdacsy in seinen bereits weiter oben zitierten, im Februar 1925 publizierten Beitrag ebenfalls zu der fast identischen Einschätzung, dass die Organisation der Kriminalpolizei durch „eine durch nichts zu übertreffende Buntscheckigkeit“ geprägt sei, die dazu führe, dass „von vornherein eine gewisse Zusammenhangslosigkeit in der Leitung“1018 bestehe. Und auch der Erfurter Kriminalkommissar Willy Gay kam in seinem im Januar 1925 veröffentlichten Beitrag nach einer ausführlichen Auflistung der Mängel der Kriminalpolizei zu dem Ergebnis, dass diese darauf zurückzuführen waren, „daß keine Zentralinstanz mit Aufsichts- und Anweisungsbefugnissen vorhanden ist, die durch bindende Vorschriften für alle Kriminalbehörden diese Mängel beseitigt“1019. Die Ergebnisse der Problemanalysen in diesen Beiträgen nahmen die erforderliche Problemlösung gleich vorweg, da einer zu weitgehenden Dezentralisierung und mangelnden Spezialisierung der Kriminalpolizei offensichtlich nur durch eine Zentralisierung und Spezialisierung entgegengewirkt werden könne. Allerdings waren verschiedene Stufen und Formen der Zentralisierung und Spezialisierung denkbar. Die weitest gehende Form der Zentralisierung war die reichsweite Bündelung von kriminalpoli- 1016 B. Weiß, Grundgedanken für die Reform der preußischen Kriminalpolizei, in: ZDPol, 21. Jg. (1924/25), Nr. 20 (20.1.1925), S. 503. 1017 Vgl. Glocker, Brauchen wir eine bewegliche Landeskriminalpolizei (24.6.1920), S. 149ff. 1018 Kajdacsy, Von der Kriminalpolizei von heute (20.2.1925), S. 577. 1019 W. Gay, Der zweckmäßige Aufbau der preuß. Landeskriminalpolizei, in: ZD- Pol, 21. Jg. (1924/25), Nr. 20 (20.1.1925), S. 509. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 275 zeilichen Kompetenzen in einer Reichskriminalpolizei bzw. einem Reichskriminalpolizeiamt, wie sie bereits im Jahr 1922 vom Reichstag grundsätzlich beschlossen worden war und auch von Wilhelm Kajdacsy und Willy Gay in ihren beiden Beiträgen gefordert wurden. Die Umsetzung dieser Maßnahme scheiterte aber letztlich am deutschen Föderalismus, so dass das entsprechende Gesetz zumindest in der Weimarer Zeit nicht in Kraft trat.1020 Die geringen Erfolgsaussichten dieses Vorhabens waren den Autoren der oben zitierten Beiträge wohl auch bekannt, da sie sich in ihren Ausführungen nicht ernsthaft mit dieser Option, sondern vielmehr mit der landesweiten Zentralisierung der kriminalpolizeilichen Aufgaben in Form einer Landeskriminalpolizei beschäftigten. Dies würde nach Bernhard Weiß im Wesentlichen die Errichtung eines Landeskriminalpolizeiamts erfordern, „d. h. einer kriminalpolizeilichen Organisation, die mit einheitlich ausgebildeten, für das gesamte Landesgebiet zuständigen Beamten und mit einheitlichen kriminaltechnischen Mitteln ausgestattet, das ganze preußische Landesgebiet gleichmäßig kriminalpolizeilich versorgt“, und sich dabei „auf die vorhandenen örtlichen Kriminalpolizeiorgane [stützt]“1021. Da der Nutzen einer solchen Form der Zentralisierung kriminalpolizeilicher Kompetenzen und damit einhergehend auch Spezialisierung der Kriminalbeamten auf der Hand lag, verwundert es nicht, dass alle Länder in den kommenden Jahren entsprechende Landeskriminalbehörden einrichteten.1022 Das Ergebnis der eben angesprochenen Spezialisierungs- und Zentralisierungstendenzen lässt sich sehr anschaulich nachvollziehen, indem man einen weiteren Beitrag von Bernhard Weiß analysiert, den dieser drei Jahre später – im April 1928 – nun nicht mehr als Chef der Berliner Kriminalpolizei, sondern als Polizeivizepräsident von Berlin in der ZDPol publizierte.1023 In diesem aus Anlass des 25jährigen Bestehens dieser Zeitschrift herausgegebenen Heft beschäftigte sich der Autor mit der historischen Entwicklung der Kriminalpolizei und ging dabei insbesondere auch auf ihren institutionellen und organisationalen Wandel ein. „Die Art ihrer Wandlung ist der Kriminalpolizei genau vorgeschrieben. Die Verbrecher sind es, die das kriminalpolizeiliche Handeln und 1020 Vgl. Wagner, Volksgemeinschaft ohne Verbrecher, S. 111ff.; Leßmann-Faust, Geschichte der Polizei, S. 23. 1021 Weiß, Grundgedanken für die Reform der preußischen Kriminalpolizei (20.1.1925), S. 504. 1022 Vgl. Wagner, Volksgemeinschaft ohne Verbrecher, S. 116ff. 1023 Vgl. Weiß, 25 Jahre Kriminalpolizei (10.4.1928), S. 209ff. IV. Die deutsche Polizei in der Zwischenkriegszeit 276 damit letzten Endes die Organisation, die Taktik und die Technik der Kriminalpolizei bestimmen. Besteht doch die Arbeit der Kriminalpolizei lediglich in der Abwehr, in der Bekämpfung des Verbrechertums. Mit der Wandlung des Verbrechertums und seiner Arbeitsmethoden muß sich daher notgedrungen auch die Tätigkeit der Kriminalpolizei ändern. Dieser Gesichtspunkt trifft für die Quantität wie für die Qualität der kriminalpolizeilichen Arbeit zu. […] Gewiß, quantitativ haben sich die Straftaten gegenüber der Zeit vor 25 Jahren nicht in besonders erschreckendem Ausmaße vermehrt. […] Aber qualitativ besteht zwischen dem Verbrechertum der Gegenwart und demjenigen vor 25 Jahren ein tiefgehender Unterschied. Gegenüber der Jetztzeit, in der ein mit allen Mitteln moderner Technik arbeitendes Spezialisten-Berufsverbrechertum, oft internationalen Charakters, die öffentliche Sicherheit in schwerster Weise bedroht, erscheinen die Verbrecher aus der Zeit vor 25 Jahren beinahe harmlos.“1024 Der Autor vertrat hier die in der damaligen Kriminalistik dominierende Ansicht, dass die Entwicklung der Kriminalpolizei nahezu ausschließlich von einem externen Faktor bestimmt wurde, nämlich der Kriminalität bzw. dem „Verbrechertum“. Dieser Faktor stand im Mittelpunkt jeder kriminalpolizeilichen Tätigkeit und galt als zentraler Treiber des institutionellen Wandels der Kriminalpolizei, der somit zu einer „mechanische[n] Antwort auf Vorgaben durch das Phänomen Kriminalität“ wurde.1025 An dieser Stelle kam nun das „Spezialisten-Berufsverbrechertum“ ins Spiel, das sich angeblich in den letzten Jahren zur größten Gefahr für die innere Sicherheit in Deutschland entwickelt hatte, so dass sich die Kriminalpolizei „notgedrungen“ an diese extern vorgegebene Entwicklung anpassen musste. Wie Bernhard Weiß in seinen folgenden Ausführungen feststellte, bedeutete dies für die Weimarer Kriminalpolizei zunächst eine stärkere Spezialisierung auf allen Ebenen. Diese Spezialisierung spielte sich zum einen auf der fachlichen Ebene bzw. der Ebene der Aus- und Fortbildung der Kriminalbeamten ab, beispielsweise indem „für alle Kriminalbeamte Ausbildungskurse auf Sonderarbeitsgebieten abgehalten [wurden], insbesondere auf dem Gebiet des Erkennungsdienstes und neuerdings auch auf dem Gebiete der Brandermittelung“1026. Zum anderen betraf die Spezialisierung aber auch die organisationale Ebene, indem „bestimmte Straftaten – näm- 1024 Weiß, 25 Jahre Kriminalpolizei (10.4.1928), S. 209 f. 1025 Vgl. Wagner, Volksgemeinschaft ohne Verbrecher, S. 80ff. (Zitat: S. 80). 1026 Weiß, 25 Jahre Kriminalpolizei (10.4.1928), S. 210. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 277 lich diejenigen, die von Erwerbsverbrechern verübt werden, und diejenigen, deren Bearbeitung eine besondere technische oder kaufmännische Sachkenntnis erfordert, – von spezialistisch geschulten Kriminalbeamten bearbeitet werden“1027. Begleitet wurden diese Spezialisierungsprozesse von einer weitgehenden Zentralisierung der Kriminalpolizei, deren Auswirkungen nach Einschätzung von Bernhard Weiß sogar „[w]eit einschneidender“1028 waren als diejenigen der Spezialisierung. Im Mittelpunkt dieser Entwicklung sah er die Einrichtung von Landeskriminalpolizeien auf der Ebene der Bundesländer, die insbesondere zur Folge hatte, „das an Stelle des früheren zusammenhangslosen Nebeneinanderarbeitens der verschiedenen örtlichen Kriminalbehörden ein systematisches Zusammenwirken zur Bekämpfung des Verbrechertums“1029 stattfinden konnte. Darüber hinaus betonte er auch die Vorzüge der mittlerweile realisierten länder- und sogar grenzüberschreitenden Zentralisierung kriminalpolizeilicher Aktivitäten im Rahmen der ‚Deutschen Kriminalpolizeilichen Kommission‘ sowie der ‚Internationalen Kriminalpolizeilichen Kommission‘. Keine Erwähnung fand hingegen die mögliche Einrichtung einer länderübergreifend tätigen Reichskriminalpolizei, was darauf hindeutete, dass dieser im Jahr 1922 vom Reichstag grundsätzlich beschlossene Zentralisierungsansatz im Jahr 1928 wohl endgültig gescheitert war. Insgesamt verdeutlichte der Beitrag von Bernhard Weiß allerdings zweifelsohne, dass die Weimarer Kriminalpolizei des Jahres 1928 die schon acht Jahre zuvor von Glocker1030 und drei Jahre zuvor von Bernhard Weiß selbst1031 in dieser Zeitschrift angedeutete, gerade aus berufsständischer Sicht vorteilhafte Entwicklung zu einer auf die Bekämpfung des ‚gewerbsmäßigen‘ Verbrechertums fokussierten, weitgehend spezialisierten und zentralisierten Organisation abgeschlossen hatte. Welche Auswirkungen diese Entwicklung auf die allgemeine Sicherheitslage in der Weimarer Republik und damit auch auf die Rolle der Polizei als Instrument staatlicher Herrschaft hatte, lässt sich nur schwer einschätzen. Grundsätzlich kann sicherlich davon ausgegangen werden, dass die Zentralisierung der Kriminalpolizei angesichts der offensichtlichen, damit verbundenen Vorzüge – insbesondere die Erleichterung der Strafverfol- 1027 Weiß, 25 Jahre Kriminalpolizei (10.4.1928), S. 210. 1028 Weiß, 25 Jahre Kriminalpolizei (10.4.1928), S. 210. 1029 Weiß, 25 Jahre Kriminalpolizei (10.4.1928), S. 212. 1030 Vgl. Glocker, Brauchen wir eine bewegliche Landeskriminalpolizei (24.6.1920), S. 149ff. 1031 Vgl. Weiß, Grundgedanken für die Reform der preußischen Kriminalpolizei (20.1.1925), S. 503ff. IV. Die deutsche Polizei in der Zwischenkriegszeit 278 gung von überregional agierenden Tätern und die effizientere Nutzung von ressourcenintensiven kriminaltechnischen Hilfsmitteln – sich tatsächlich positiv auf die Möglichkeiten zur Bekämpfung der Kriminalität auswirkte. Dies müsste prinzipiell auch in Bezug auf die Spezialisierung der Kriminalpolizei gelten, da der Erwerb von Spezialkenntnissen und die Fokussierung der Spezialdezernate auf bestimmte Kriminalitätsphänomene und Tätergruppen sicherlich zielgerichtetere und damit auch effektivere Ermittlungen ermöglichten. Äußerst fraglich dürfte hingegen der Nutzen der in den Publikationen in der ZDPol immer wieder hervorgehobenen Fokussierung der Kriminalpolizei auf die Bekämpfung des ‚gewerbsmäßigen‘ Verbrechertums gewesen sein. Folgt man der die damalige Kriminalistik dominierenden – und bis weit in die 1970er Jahre verbreiteten1032 – Perseveranzhypothese von Robert Heindl, die davon ausging, dass ‚gewerbsmäßige‘ Verbrecher sich auf bestimmte Straftaten spezialisierten und dabei immer dieselben Techniken verwendeten, so dass man sie anhand der Vorstrafen identifizieren könnte1033, dann deutete die Kriminalitätsstatistik in der Weimarer Zeit eher darauf hin, dass diese Tätergruppe keine außergewöhnlich große Gefährdung für die öffentliche Sicherheit darstellte.1034 Patrick Wagner kommt in Bezug auf die Bedeutung der ‚gewerbsmäßigen‘ Rückfall- oder Mehrfachtätern zu dem Ergebnis, „daß für die Auseinandersetzung zwischen rückfälligen Straftätern und den Strafverfolgern in der Weimarer Republik eine dramatische Zuspitzung nicht belegbar, ja daß die Zahlen eher eine Entspannung zu signalisieren scheinen und daß ein ursächlicher Zusammenhang zwischen dem Wirken von Rückfälligen und den markanten Steigerungen registrierter Kriminalität in den Krisenjahren bis 1923 und ab 1929 nicht erkennbar, ja sogar unwahrscheinlich ist“1035. Dementsprechend dürfte die starke Fokussierung der Kriminalpolizei auf das ‚gewerbsmäßige‘ Verbrechertum sich zwar positiv auf die Bekämpfung der Tätergruppe der Rückfall- oder Mehrfachtäter und der von ihr üblicherweise begangenen Delikte – z. B. Einbruch, Betrug oder Zuhälterei – ausgewirkt haben. Angesichts der begrenzten personellen und finanziellen 1032 Vgl. B. Niggemeier, Kriminalpolizei, in: R. Sieverts, H. J. Schneider [Hrsg.], Handwörterbuch der Kriminologie, Bd. 2, 2. Aufl., Berlin 1977, S. 23. 1033 Vgl. R. Heindl, Der Berufsverbrecher – Ein Beitrag zur Strafrechtsreform, 5. Aufl., Berlin 1927, S. 186ff. 1034 Vgl. Wagner, Volksgemeinschaft ohne Verbrecher, S. 37ff. 1035 Wagner, Volksgemeinschaft ohne Verbrecher, S. 39 f. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 279 Ressourcen der Kriminalpolizei dürfte dies allerdings zu Lasten der Bekämpfung von nicht-perseveranten Einmal- oder Gelegenheitstätern und der zahlreichen und vielfältigen, von dieser sehr viel größerem Tätergruppe begangenen Delikten geschehen sein, so dass die Auswirkungen auf die allgemeine Kriminalitätslage unklar und die Zweckmäßigkeit dieser Schwerpunktsetzung zweifelhaft sind. Insofern besteht durchaus Anlass zu der Vermutung, dass die Fokussierung der Weimarer Kriminalpolizei auf die Bekämpfung des ‚Berufsverbrechertums‘ – wie weiter oben bereits erörtert – ein (mehr oder weniger unbewusster) Vorwand gewesen sein könnte, um die von ihr zur Verbesserung des beruflichen Status sowie der Arbeitsund Versorgungsbedingungen der Kriminalbeamten gewünschte Spezialisierung und Zentralisierung zu rechtfertigen. Ob die Bekämpfung des ‚Berufsverbrechertums‘ aber einen wichtigen Beitrag zur Verbesserung der allgemeinen Kriminalitätslage in der Weimarer Republik leistete, ist hingegen äußerst fraglich ist. Ökonomisierung Die Modernisierung der Polizei in den ‚ruhigen‘ Jahren der Weimarer Republik hatte zudem eine ökonomische Dimension. So enthielten die weiter oben betrachteten, in der ZDPol publizierten Beiträge neben den zahlreichen fachlichen Argumenten, die für die eben beschriebene Spezialisierung und Zentralisierung sprachen, auch zahlreiche Hinweise auf die schwierigen fiskalischen Rahmenbedingungen in diesen Jahren, die die Ausschöpfung der damit verbundenen Vorzüge und ganz allgemein die Polizeiarbeit deutlich erschwerten. Beispielsweise betonte Wilhelm Kajdacsy, dass die Einrichtung einer für ganz Deutschland zuständigen Reichskriminalpolizei „bisher immer an der Kostenfrage gescheitert ist“1036, Willy Gay stellte in Bezug auf die von ihm geforderte Einrichtung einer Landeskriminalpolizei fest, dass diese „nur geringe Mittel erfordern wird“1037 und somit den Staatshaushalt kaum belasten würde, und Bernhard Weiß bedauerte, dass zwei von ihm vorgeschlagene, sehr umfassende und effektive Formen der Zentralisierung kriminalpolizeilicher Aufgaben sich „für absehbare Zeit aus finanziellen Gründen nicht verwirklichen“ ließen bzw. „praktisch undurchführbar“ seien, weil sie „die finanziellen Kräfte des Staates c) 1036 Kajdacsy, Von der Kriminalpolizei von heute (20.2.1925), S. 577. 1037 Gay, Der zweckmäßige Aufbau der preuß. Landeskriminalpolizei (20.1.1925), S. 509. IV. Die deutsche Polizei in der Zwischenkriegszeit 280 übersteigen würde[n]“1038. Auch wenn insgesamt festgehalten werden muss, dass die in den zitierten Beiträgen angeführten ökonomischen Argumente eine eher untergeordnete Rolle spielten und der Schwerpunkt der Ausführungen stets sehr eindeutig auf den fachlichen Vorteilen einer Zentralisierung kriminalpolizeilicher Aufgaben lag, so waren sie aber doch insofern entscheidend, als sie von vornherein die in Frage kommenden organisatorischen Alternativen stark einschränkten und Organisationsmodelle, die vermutlich effektiver, aber eben auch kostenintensiver waren, ausschlossen. Insofern waren gewisse Ökonomisierungstendenzen in der Kriminalpolizei wie in allen anderen Polizeisparten unübersehbar. Analog zu Elmar Altvaters Definition von Ökonomisierung als „Unterwerfung sozialer, politischer und natürlicher Verhältnisse unter das ökonomische Prinzip“1039 soll unter Ökonomisierung der Polizei die Unterwerfung von sicherheitspolitischen und polizeifachlichen Denk- und Handlungsmustern unter das ökonomische Prinzip verstanden werden. Dass sich solche ökonomisch geprägten Betrachtungsweisen im polizeilichen fachwissenschaftlich-berufsständischen Diskurs zunehmend zur Regel entwickelten, zeigten andere in der ZDPol erschienene Aufsätze, die sich mit arbeitsorganisatorischen Innovationen in der Polizei beschäftigten und dabei ökonomischen Argumenten eine hohe Bedeutung beimaßen. So veröffentlichte beispielsweise Wilhelm Günther, Amtsrat im preußischen Innenministerium, im Juni und Juli 1927 einen sehr ausführlichen, in drei Teilen erschienen Beitrag, dessen Titel zwar „Von der Neugestaltung des Bürowesens in der staatlichen Polizei“ lautete, der sich aber nur mit einer arbeitsorganisatorischen Neuerung beschäftigte, nämlich mit dem Einsatz von Karteien anstelle der bis dahin üblichen Tagebücher.1040 Die umfassenden, tiefgehenden und akribischen, mit vielen Beispielen angereicherten Analysen von Wilhelm Günther deuten darauf hin, dass diese Maßnahme von enormer praktischer Bedeutung gewesen sein dürfte. Die vielfältigen, detaillierten Abwägungen der Vor- und Nachteile dieser Innovation brauchen an dieser Stelle nicht dargestellt zu werden; interessant ist 1038 Weiß, Grundgedanken für die Reform der preußischen Kriminalpolizei (20.1.1925), S. 504. 1039 E. Altvater, Die Welt als Markt? in: F. Müller, M. Müller [Hrsg.], Markt und Sinn – Dominiert der Markt unsere Werte? Frankfurt a. M. u. a. 1996, S. 33. 1040 Vgl. W. Günther, Von der Neugestaltung des Bürowesens in der staatlichen Polizei, in: ZDPol, 24. Jg. (1927), Nr. 11 (5.6.1927), S. 253ff., Nr. 12 (20.6.1927), S. 286ff., Nr. 13 (5.7.1927), S. 318ff. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 281 vielmehr die zentrale Bedeutung, die ökonomische Argumente dabei spielten und die bereits in den ersten Sätzen des Beitrags deutlich hervortraten: „Noch bis vor einigen Jahren galt das Tagebuch als eine notwendige Einrichtung, ohne die man sich einen Behördenbetrieb nicht denken konnte. Erst als die Rationalisierungsbestrebungen einsetzten, fing man an, seine Zweckmäßigkeit und Unentbehrlichkeit anzuzweifeln. […] Ohne auf den Wert der bereits erwähnten Rationalisierungsbestrebungen näher einzugehen, muß festgestellt werden, daß ihnen der gesunde Gedanke zugrunde liegt, den zu erstrebenden Arbeitserfolg mit dem denkbar geringsten Maß an Kraft, Zeit und Material herbeizuführen. Dieses ökonomische Grundgesetz gilt selbstverständlich auch für den Behördenbetrieb, wenn auch mit der Einschränkung, daß die Sicherheit des Betriebes und die Ordnung des Geschäftsganges […] nicht leiden dürfen.“1041 Eine noch deutlichere Bezugnahme auf die ökonomische Dimension dieser arbeitsorganisatorischen Innovation ist nur schwer vorstellbar. Wie die weiteren Ausführungen in diesem Beitrag verdeutlichten, versprach die Einführung von Karteien auch qualitative Verbesserungen der Verwaltungsprozesse in Polizeibehörden, allerdings wurden sie nur am Rande erwähnt, wohingegen die Darstellung der Effizienz- und Kostenvorteile dieses Instruments einen wesentlich größeren Raum einnahm. Im Ergebnis führten die ausführlichen Analysen daher zu dem eindeutigen Ergebnis, dass moderne Karteien wesentlich effizienter seien als Tagebücher und diese daher ersetzen sollten. Dabei verwies der Autor zwar an einer Stelle darauf, dass dies „allein schon in der ungünstigen Finanzlage begründet ist“1042, ansonsten deuteten die gewählten Formulierungen aber darauf hin, dass diese Maßnahme auch unter günstigeren fiskalischen Rahmenbedingungen in der Polizei geboten wären und sich vielmehr aus dem oben erwähnten, allgemeingültigen „ökonomischen Grundgesetz“ ergäben. Dies verdeutlichte auch die folgende Passage aus dem letzten Teil dieses Beitrags: „Derartige Beispiele und Richtlinien zeigen Wege, wie der Geschäftsgang verbilligt und beschleunigt werden kann und wie am ersten die Geschäftsstellen, Registraturen und Kanzleien allgemein entlastet und Kräfte für wichtigere und nötigere Aufgaben verfügbar gemacht wer- 1041 Günther, Von der Neugestaltung des Bürowesens (5.6.1927), S. 253 f. 1042 Günther, Von der Neugestaltung des Bürowesens (5.6.1927), S. 254. IV. Die deutsche Polizei in der Zwischenkriegszeit 282 den können. Ziel und Streben der bei einer staatlichen Polizeiverwaltung für die Büroreform zuständigen Beamten muß deshalb sein, durch Vergleichen der einzelnen Arbeitsgebiete den Geschäftsbetrieb ständig daraufhin zu beobachten, wo beschleunigt und erspart werden kann.“1043 Erneut betonte Wilhelm Günther hier sehr deutlich die Notwendigkeit, permanent nach Möglichkeiten zu suchen, wie die Polizei ihre Verwaltungsprozesse effizienter und kostengünstiger gestalten könnte. Insgesamt deutete dies darauf hin, dass die im Zuge der Modernisierung und Professionalisierung der Polizei in den mittleren Jahren der Weimarer Republik umgesetzten arbeitsökonomischen Innovationen auch Ausdruck einer zunehmenden Ökonomisierung der öffentlichen Verwaltung und damit eben auch der Polizei gewesen sein dürften. Ein weiteres Beispiel für die zunehmende Bedeutung von ökonomischen Argumenten in dieser Zeit war schließlich der im Dezember 1928 in der ZDPol erschienene Beitrag des Berliner Polizeiobersekretärs Bowe, in dem er sich mit der Frage auseinandersetzte, ob es zweckmäßig sei, mehr nichtbeamtetes Personal bei der Polizei einzusetzen.1044 Die Gründe, warum dies zweckmäßig sein sollte bzw. warum er sich überhaupt mit diesem Thema beschäftigte, erläuterte er zu Beginn seines Beitrags folgenderma- ßen: „Das stetig wachsende Bedürfnis an Polizeibeamten hat in den letzten Jahren dem Gedanken den Weg geebnet, bei den staatlichen Polizeiverwaltungen Preußens im Bürodienst tätige Exekutivbeamte für den Au- ßendienst dadurch freizumachen, daß für die bisher von ihnen wahrgenommene Tätigkeit Zivilangestellte eingestellt werden. Daneben haben Erwägungen, die auf dem Gebiete der Rationalisierung liegen, dazu geführt, freiwerdende Polizeikanzleibeamtenstellen in Stenotypistinnenstellen umzuwandeln. […] Die Verwendung von nichtbeamteten Kräften wird dann zu befürworten sein, wenn hierdurch entweder Exekutivbeamte für den Außendienst freigemacht werden können, oder wenn die Verwendung von solchen Kräften wirtschaftlicher als diejenige von Beamten erscheinen muß.“1045 1043 Günther, Von der Neugestaltung des Bürowesens (5.7.1927), S. 320. 1044 Vgl. Bowe, (Vorname fehlt), Mehr nichtbeamtete Kräfte bei der Polizei? in: ZDPol, 25. Jg. (1928), Nr. 24 (20.12.1928), S. 763ff. 1045 Bowe, Mehr nichtbeamtete Kräfte bei der Polizei? (20.12.1928), S. 763. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 283 Die ökonomische Dimension seiner Argumentation war aufgrund seiner expliziten Bezugnahme auf Rationalisierungsbestrebungen und des von ihm geforderten Abwägens, ob nichtbeamtetes Personal wirtschaftlicher als beamtetes war, kaum zu übersehen. Dabei meinte er mit ‚wirtschaftlicher‘ nicht etwa ‚effizienter‘, sondern durchaus ‚kostengünstiger‘. Dies zeigte sich besonders deutlich, als er im weiteren Verlauf des Beitrags die Polizei dezidiert dazu aufforderte, „das Ziel der Ersparnis zugunsten der Staatskasse nicht [zu] vergessen“ und freiwerdende Stellen im Innendienst nicht etwa durch lebensältere oder gesundheitlich eingeschränkte Schutzpolizisten zu besetzen, sondern vielmehr „bei der Industrie [zu] lernen“ und „junge, eben schulentlassene Leute ein[zu]stellen“1046, die wegen ihres geringen Gehalts deutlich kostengünstiger waren. Neben dieser rein ökonomischen Argumentation, die fiskalisch motiviert war, sprach Bowe aber auch Engpässe bei den für den Außendienst einsetzbaren Polizeibeamten an, die es erforderlich machten, das entsprechende Personal auch dort effizient einzusetzen, anstatt es im Innendienst mit Aufgaben zu beschäftigen, die ebenso von Verwaltungs- oder Bürofachkräften erledigt werden konnten. Auch wenn der Autor dies nicht explizit erwähnte, war die angesprochene Personalknappheit auf die Vorgaben der Interalliierten Militär-Kontrollkommission zurückzuführen, dass die Personalstärke der deutschen Polizei maximal 150.000 Mann betragen durfte, von denen 85.000 Mann auf Preußen entfielen.1047 Diese offensichtlich von der Polizei als massive Einschränkung empfundene Vorgabe wurde auch in zahlreichen anderen Beiträgen in der ZDPol erwähnt, so beispielsweise in einem auf einer Rede auf der 7. Preußischen Polizeiwoche in Köln basierenden, im Juni und Juli 1928 in zwei Teilen erschienenen Beitrag des Leiters der Polizeiabteilung im Preußischen Innenministerium, Erich Klausener, der seine Ausführungen zu den aktuellen organisatorischen Herausforderungen der Polizei mit dem Satz begann: „Es kann nicht deutlich genug immer wieder und wieder darauf hingewiesen werden, daß die Zahl der staatlichen Polizeibeamten aller Dienstgrade 67.000 Köpfe nicht übersteigen darf.“1048 1046 Bowe, Mehr nichtbeamtete Kräfte bei der Polizei? (20.12.1928), S. 765. 1047 Vgl. Leßmann-Faust, Geschichte der Polizei, S. 21. 1048 E. Klausener, Tagesfragen der Polizei, in: ZDPol, 25. Jg. (1928), Nr. 12 (20.6.1928), S. 377. Die Differenz zwischen den hier genannten 67.000 staatlichen Polizeibeamten und den zuvor angeführten 85.000 umfasst insb. die kommunalen Polizeibeamten sowie die Landjäger. IV. Die deutsche Polizei in der Zwischenkriegszeit 284 Anschließend beschäftigte er sich mit den Möglichkeiten, die sich aus der daraus resultierenden Personalknappheit ergebenden Probleme erfolgreich zu lösen. Dabei ging er allerdings noch einen Schritt weiter als Bowe und plädierte nicht nur für die Einstellung von nichtbeamteten Bürokräften, sondern sogar für eine komplette Auslagerung von polizeilichen Aufgaben an andere Behörden: „Materiell werden wir ernsthaft prüfen müssen, welche Aufgaben in Zukunft als polizeiliche Aufgaben überhaupt anzusehen sind und welche Aufgaben daneben vielleicht nach moderner Anschauung aus dem Aufgabenkreis der Polizeiverwaltung entlassen und der Selbstverwaltung übertragen werden können. […] Ich pflege diesen Komplex von Fragen als ‚Entpolizeilichung‘ zu bezeichnen. Die Vorarbeiten sind im Gange. Sie erfordern eine Unsumme von Arbeit […]“1049 Auch wenn die Aussage von Erich Klausener recht vage blieb und sein Hinweis auf die noch bevorstehende „Unsumme an Arbeit“ sicherlich dahingehend zu verstehen war, dass es sich hierbei um eine sehr langfristiges Vorhaben handelte, bei dessen Umsetzung mit erheblichen Widerständen zu rechnen war, so deutete allein schon die Erwähnung dieser drastischen organisatorischen Maßnahme in einer Rede auf einem großen Kongress darauf hin, wie umfassend und grundlegend die in diesen Jahren stattfindende Modernisierung und Ökonomisierung der Polizei angelegt war. Im weiteren Verlauf dieses Beitrag behandelte Erich Klausener dann eine ganze Reihe von weiteren arbeitsorganisatorischen sowie technischen Innovationen, die auch schon in den Aufsätzen von Wilhelm Günther und Herbert Peucker sowie weiter oben von Ferdinand Friedensburg, Herbert Schmidt und Heinrich Paetsch angesprochen worden waren. So forderte er beispielsweise eine Optimierung der Arbeitsorganisation der Polizei „entweder durch starke Dezentralisation von Arbeiten auf diejenige Stelle, die den tatsächlichen Verhältnissen am nächsten steht und sie daher am besten und schnellsten bearbeiten kann, oder durch Zentralisation von Arbeiten, die allen Polizeiverwaltungen gleichmäßig obliegen und überflüssige Arbeit verursachen“1050. Zudem hielt er eine Vereinheitlichung der Geschäftsverteilungs- und Aktenpläne aller Polizeibehörden, die Abschaffung der Tagebücher, den Einsatz von stehenden Karteien in Trogpulten sowie von Schreib- und Rechenmaschinen und ganz allgemein eine weitgehende Technisierung der Polizei für erforderlich. Selbstverständlich fehlte auch 1049 Klausener, Tagesfragen der Polizei (20.6.1928), S. 378. 1050 Klausener, Tagesfragen der Polizei (20.6.1928), S. 378. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 285 der Hinweis auf die ‚Politik der leeren Kassen‘1051 nicht, dass einige dieser Maßnahmen vermutlich „auf den fast unüberwindlichen Widerspruch des Finanzministers stoßen“ würden und „auf die Staatsfinanzen Rücksicht genommen werden“1052 müsse. Insofern unterstrich dieser Beitrag von Erich Klausener, der als Leiter der Polizeiabteilung im preußischen Innenministerium zu den wichtigsten und einflussreichsten Entscheidungsträgern in der deutschen Polizei zählte, noch einmal, dass die Polizei in den mittleren Jahren der Weimarer Republik einen grundlegenden und umfassenden Modernisierungs- und Professionalisierungsprozess durchlief, der neben der Einführung von verschiedenen technisch-wissenschaftlichen und arbeitsorganisatorischen Innovationen auch eine zunehmende Ökonomisierung des Polizeiwesens beinhaltete. Demokratisierung ‚von oben‘ Gleichwohl ist zu davon auszugehen, dass ein solcher umfassender Professionalisierungs- und Modernisierungsprozess gerade in der Polizei, deren Daseinszweck die Sicherung der staatlichen Herrschaft ist, auch eine politisch-ideologische Dimension haben musste. Für die Polizei der Weimarer Republik lief dies im Wesentlichen auf eine Verankerung von demokratischen Grundwerten in ihrem organisationskulturellen Selbstverständnis hinaus. Angesichts der personellen Zusammensetzung der Weimarer Polizei waren durchaus Zweifel an ihrer demokratischen Gesinnung angebracht. Während das Korps der Polizeiwachtmeister sehr heterogen zusammengesetzt und auch politisch nicht eindeutig zu verorten war, blieb das Polizeioffizierskorps, das fast ausschließlich mit weltkriegserfahrenen, ehemaligen Heeresoffizieren besetzt war, den gesellschaftlichen und militärischen Idealen der Wilhelminischen Monarchie verpflichtet und vertrat überwiegend – teilweise sogar sehr deutlich – rechtsradikale und antirepublikanische Positionen.1053 Dementsprechend versuchten vor allem die vom Sozialdemokraten Otto Braun geführte preußische Landesregierung, die zwischen 1921 und 1932 fast ununterbrochen im Amt war, und hier insbesondere seine Parteigenossen Carl Severing, der zwischen 1920 d) 1051 Vgl. A. Pelizzari, Die Ökonomisierung des Politischen – New Public Management und der neoliberale Angriff auf die öffentlichen Dienste, Konstanz 2001, S. 37ff. 1052 Klausener, Tagesfragen der Polizei (20.6.1928), S. 378. 1053 Vgl. Leßmann-Faust, Die Preußische Schutzpolizei, S. 131ff. und S. 153ff. IV. Die deutsche Polizei in der Zwischenkriegszeit 286 und 1926 sowie zwischen 1930 und 1932 als preußischer Innenminister und zwischen 1928 und 1930 als Reichsinnenminister amtierte, sowie Albert Grzesinski, der zwischen 1926 und 1930 preußischer Innenminister war, in den mittleren Jahren der Weimarer Republik eine Politik der ‚Demokratisierung der Verwaltung‘ umzusetzen1054, die auch die preußische Polizei umfassen sollte1055, um diese „zur Arbeit in einem demokratisch verfassten Gemeinwesen, zur Orientierung an demokratischen Leitbildern zu befähigen“1056. Diese Demokratisierung der Polizei ‚von oben‘ hatte sowohl eine interne als auch eine externe Dimension. Die interne Dimension betraf vor allem die Arbeitsbeziehungen und hier insbesondere das Vorgesetzten-Mitarbeiter-Verhältnis, das in der Polizei traditionell von militärischen Werten wie Gehorsam und Disziplin geprägt war, die in der demokratischen Grundordnung der Weimarer Republik unzeitgemäß wirkten, so dass eine Ergänzung um partizipative Führungselemente angebracht schien. Zur externen Dimension gehörte neben der grundsätzlich erfolgten, aber in der Praxis wenig erfolgreich umgesetzten Öffnung des Polizeiberufs für Bewerber ohne militärische Vorbildung oder Erfahrung und insbesondere auch für junge Männer aus dem Arbeitermilieu1057 vor allem eine umfassende Öffentlichkeitsarbeit auf der Grundlage von Publikationen, Ausstellungen und Festen, die ein positives Bild einer demokratischen und republikanischen Werten verpflichteten Polizei in den Medien vermitteln und eine Annäherung zwischen der Polizei und der Bevölkerung bewirken sollte.1058 Als besonders exponiertes Beispiel dieser Politik gilt die ‚Große Polizeiausstellung‘, die 1926 in Berlin stattfand und auf der die deutsche Polizei sehr publikumswirksam ihr modernes, demokratisches ‚Gesicht‘ zeigen konnte.1059 1054 Vgl. T. Albrecht, Für eine wehrhafte Demokratie – Albert Grzesinski und die preußische Politik in der Weimarer Republik, Bonn 1999, S. 155ff. 1055 Vgl. Leßmann-Faust, Gewalt und Gewaltmonopole, S. 254 f. 1056 Leßmann-Faust, Weimarer Republik, S. 38. 1057 Vgl. Knatz, Polizei in der Weimarer Republik, S. 41; Bessel, Militarisierung und Modernisierung, S. 341 f.; Leßmann-Faust, Die Preußische Schutzpolizei, S. 132; Leßmann-Faust, Weimarer Republik, S. 39. 1058 Vgl. Leßmann-Faust, Weimarer Republik, S. 39; Bessel, Militarisierung und Modernisierung, S. 328 f.; H.-G. Jaschke, Geschichte der deutschen Polizei vor und nach 1945: Kontinuitäten und Brüche, in: Bundeskriminalamt [Hrsg.], Das Bundeskriminalamt stellt sich seiner Geschichte – Dokumentation einer Kolloquienreihe, Köln 2008, S. 43 f.; Bessel, Policing, S. 195 f. 1059 Vgl. Bessel, Policing, S. 187 f.; Spieker, Passer à l’Acte, S. 150ff. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 287 Dass die Polizei nach den äußerst turbulenten und gewaltsamen Anfangsjahren der Weimarer Republik alles andere als eine vom Großteil der Bevölkerung getragene und akzeptierte Institution war, zeigten zahlreiche Anmerkungen in verschiedenen in der ZDPol veröffentlichten Beiträgen. Dort fanden sich auch oftmals Forderungen nach einer ‚Demokratisierung‘ der Polizei im Sinne einer Annäherung an die Vorstellungen und Bedürfnisse der Bevölkerung – und damit auch der unteren, der Polizei besonders kritisch gegenüberstehenden Bevölkerungsschichten. Allerdings blieben diese Forderungen in der Regel recht vage und waren darüber hinaus gekennzeichnet durch das weitgehende Fehlen von Selbstkritik und den Verzicht auf eine objektive Analyse der Ursachen für die geringe Akzeptanz der Polizei in der Bevölkerung. Ein typisches, frühes Beispiel hierfür war der im März 1924 vom Breslauer Polizeipräsidenten Wilhelm Kleibömer publizierte Aufsatz mit dem Titel „Die Schutzpolizei und die öffentliche Meinung“, der mit den folgenden Sätzen begann: „Die Schutzpolizei hat es schwer, sich in der öffentlichen Meinung durchzusetzen. Die staatliche Autorität und deren Träger stoßen heute mehr als je auf starken, reflexartigen Widerstand. Vereinzeltes, unliebsames Zusammentreffen mit den staatlich bestellten Hütern der Ordnung macht leicht voreingenommen und öffnet willig das Ohr für abträgliche Kritik oder gar hetzerische Schlagworte, die zu prägen jederzeit verantwortungslose oder böswillige Elemente bereit sind. Das häufig unumgänglich notwendige harte Zufassen reizt auch gutmütige, urteilslose Unbeteiligte zu gegnerischer Stellungnahme und verbreitert damit die ablehnende Voreingenommenheit. Einzelfälle, schief gesehen, aufgebauscht, entstellt, geben das unwahrhaftige Zerrbild des von Machtdünkel und Willkür beseelten, gewalttätigen Volksfeindes, der sich in Wahrheit unablässig als Volksfreund zu betätigen bemüht, mit Rat und Tat für Hilfsbedürftige und -suchende jeglicher Art und der Gesundheit und Leben einsetzt zum Schutz seiner Volksgenossen und ihrer staatlichen Gemeinschaft. Darüber, als etwas Selbstverständliches, wird hinweggesehen. Voreingenommenheit und Feindseligkeit immer mehr zu beseitigen, und ein Vertrauensverhältnis zu allen ordnungsliebenden Volksteilen zu schaffen, muß das Bestreben der Schutzpolizei sein.“1060 1060 W. Kleibömer, Die Schutzpolizei und die öffentliche Meinung, in: ZDPol, 20. Jg. (1923/24), Nr. 23 (5.3.1924), S. 399. IV. Die deutsche Polizei in der Zwischenkriegszeit 288 Der Rest des Beitrags, in dem Wilhelm Kleibömer für die Einrichtung von Armenspeisungen in den Kantinen der Schutzpolizei als Mittel zu einer Verbesserung der öffentlichen Wahrnehmung der Polizei plädierte, ist an dieser Stelle nicht von Belang. In dieser Anfangspassage spiegelten sich allerdings sehr anschaulich die äußerst problematische und von gegenseitigem Misstrauen geprägte Beziehung zwischen Polizei und Bevölkerung sowie das negative öffentliche Bild der Polizei im Jahr 1924 wider. Gerade die von ihm zur Beschreibung des Fremdbildes der Polizei gewählte, drastische Bezeichnung des „gewalttätigen Volksfeindes“ lässt vermuten, dass die Polizei in breiten Teilen der Bevölkerung nicht nur auf wenig Unterstützung, sondern vielmehr auf völlige Ablehnung stieß. Die Ursachen für diese unerfreuliche Situation sah der Breslauer Polizeipräsident allerdings nicht in der Art und Weise, wie die Polizei sich im Alltag sowie bei besonderen Einsatzanlässen gegenüber der Bevölkerung verhielt, sondern ausschließlich in der Voreingenommenheit der Bevölkerung und der bewusst verfälschten Darstellung der Polizei in der Presse, die er zwar nicht explizit erwähnte, aber angesichts der von ihm gewählten Formulierung („Schlagworte, die zu prägen jederzeit verantwortungslose oder böswillige Elemente bereit sind“) zweifellos meinte. Auf Selbstkritik verzichtete er gänzlich. Dass diese Einschätzung kaum der Realität entsprochen und die Polizei mit hoher Wahrscheinlichkeit eine erhebliche Teilschuld am zerrütteten Verhältnis getragen haben dürfte, ist offensichtlich und war vermutlich auch dem Autor bewusst. Wie der letzte Satz der zitierten Passage verdeutlicht, war sich Wilhelm Kleibömer durchaus im Klaren darüber, dass die negativen Beziehungen der Polizei zum Bürger dringend verbessert werden mussten und dass diese Verbesserung Aufgabe der Polizei war, die sich aktiv um eine Annäherung an und eine vertrauensvolle Interaktion mit dem Publikum bemühen sollte. Allerdings sind durchaus Zweifel angebracht, ob diese Publikation angesichts der einseitigen, von jeglicher Selbstkritik freien und sicherlich unzutreffenden Darstellung der Ursachen für die negative öffentliche Wahrnehmung der Polizei tatsächlich dazu beitrug, bei seiner im Wesentlichen aus Polizeibeamten bestehenden Leserschaft ein entsprechendes Problembewusstsein zu schaffen und diese zu mehr Bürgernähe zu motivieren. Es gab aber auch gelungenere oder zumindest ausgewogenere Beiträge in der ZDPol, die sich mit dem schwierigen Verhältnis zwischen Polizei und Bevölkerung beschäftigten. So wurde im Juni 1924 unter dem Titel „Welche Anforderungen stellen Sie an die Fähigkeiten der Polizeibeamten?“ eine im Jahr 1923 entstandene Hausarbeit aus dem ersten Polizeima- 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 289 jor-Anwärter-Lehrgang in Berlin publiziert.1061 Darin beschäftigte sich der namentlich nicht angeführte Autor zunächst ausführlich mit den erforderlichen physischen und psychischen Merkmalen eines Polizeibeamten, ohne militärisch geprägten Eigenschaften wie Stolz, Ehre oder Willensstärke dabei eine zentrale Bedeutung zuzubilligen und Disziplin sowie Gehorsam auch nur zu erwähnen. In Bezug auf die Interaktion zwischen Polizei und Bevölkerung äußerte er sich folgendermaßen: „Unter den geistigen Gefühlen, die von dem Beamten verlangt werden müssen, sind wohl die ethischen Gefühle an erste Stelle zu setzen, zumal in der heutigen Zeit großer Notlage breitester Volksschichten. Der Beamte versehe seinen Dienst nicht wie eine Maschine, sondern mit Lust und Liebe zum Beruf und mit warmem Mitverstehen und Mitfühlen für seine Umwelt. Er tut Dienst am Volke und hat deshalb nicht nur allgemein für Ruhe, Sicherheit und Ordnung zu sorgen, sondern sei auch ‚mit dem Herzen dabei‘ und stets darauf bedacht, schwachen und unbeholfenen Personen hilfsbereit beizuspringen und ihnen Schutz zu gewähren, handle es sich darum, ein altes Weiblein über eine stark belebte Straße zu führen, oder um die Betreuung eines durch Unfall Verletzten. Diese Rücksichtnahme gegen das Publikum soll jedoch nicht als Weichmütigkeit und Wehleidigkeit überhandnehmen, findet vielmehr ihre natürliche Grenze in den ihm gestellten Aufgaben. […] so wird er auch in der Lage sein, sich […] dem Idealbilde des Polizeibeamten zu nähern, der sich bei allen ordnungsliebenden Volksschichten das Maß von Achtung und Vertrauen erringt, an dem es zum Schaden der Staatsautorität leider noch recht oft mangelt.“1062 Obwohl auch hier auf eine genauere Analyse der Ursachen für die im letzten Satz attestierte, schwierige Beziehung zwischen der Polizei und dem Bürger verzichtet wurde, so fand immerhin auch keine einseitige und wenig plausible Schuldzuweisung an die Medien oder andere gesellschaftliche Gruppen statt. Zudem beschränkte er sich nicht nur auf einen allgemeinen Aufruf zur Verbesserung dieses Verhältnisses, sondern konkretisierte seine diesbezüglichen Vorstellungen mit Verhaltensempfehlungen, die zwar etwas klischeehaft („altes Weiblein über eine stark belebte Straße füh- 1061 Vgl. o. V., Welche Anforderungen stellen Sie an die Fähigkeiten der Polizeibeamten? – Hausarbeit aus dem ersten Polizeimajor-Anwärter-Lehrgang in Berlin 1923, in: ZDPol, 21. Jg. (1924/25), Nr. 6 (20.6.1924), S. 141ff. 1062 Vgl. o. V., Welche Anforderungen stellen Sie an die Fähigkeiten der Polizeibeamten? (20.6.1924), S. 142 f. IV. Die deutsche Polizei in der Zwischenkriegszeit 290 ren“) und pauschalisierend („nicht wie eine Maschine“) wirkten, die sich aber eindeutig an seine aus Polizeibeamten bestehende Leserschaft richteten und diese damit in die Pflicht nahm, auf den Bürger zuzugehen und aktiv zu einer Verbesserung ihres öffentlichen Ansehens beizutragen. Die antithetischen Formulierungen könnten zudem durchaus als verdeckte Selbstkritik gemeint und auch so verstanden worden sein, so dass beispielsweise die Aussage, der Polizeibeamte „versehe seinen Dienst nicht wie eine Maschine, sondern mit Lust und Liebe für den Beruf“, ein dezenter Hinweis darauf gewesen sein könnte, dass Ersteres oftmals der Fall war. Wichtig war in diesem Kontext sicherlich auch der Hinweis, dass die angestrebte Bürgernähe auch eine „natürliche Grenze“ habe, was sich unmittelbar aus der Rolle der Polizei als Instrument staatlicher Herrschaft und der damit einhergehenden Notwendigkeit, bei Bedarf unmittelbaren Zwang oder sogar Gewalt gegenüber dem Bürger auszuüben, ergab. Dies dürfte den Lesern des Beitrags verdeutlicht haben, dass der Autor sich der besonderen Herausforderungen bewusst war, mit denen Polizeibeamte im täglichen Umgang mit der Bevölkerung konfrontiert wurden, und somit dessen Glaubwürdigkeit erhöht haben. Schließlich ist noch darauf hinzuweisen, dass es sich beim Autor dieser Hausarbeit um einen angehenden Polizeimajor handelte, d. h. um ein Mitglied des Polizeioffizierskorps, das als tendenziell rechtsradikal, monarchistisch und militärischen Werten und Traditionen verpflichtet galt.1063 Da man davon ausgehen muss, dass auch der Dozent, der diese Hausarbeit korrigieren musste, ein Polizeioffizier war, sprechen die oben zitierten Aussagen dafür, dass zu Beginn der ‚ruhigen’ Jahre der Weimarer Republik auch in diesen Kreisen eine gewisse Notwendigkeit gesehen wurde, eine engere und vertrauensvollere Beziehung zwischen der Polizei und dem Publikum herbeizuführen. Dass diese Notwendigkeit auch weiter oben in der polizeilichen Hierarchie gesehen wurde, belegte ein im Juni 1925 in der ZDPol erschienener, halbseitiger und damit recht kurzer Bericht über den späteren preußischen Innenminister Albert Grzesinski anlässlich seiner Ernennung zum Polizeipräsidenten von Berlin.1064 In diesem Beitrag, der offensichtlich dazu diente, den neuen Polizeipräsidenten der Leserschaft vorzustellen, wurde nicht nur darauf hingewiesen, dass er aus einer Arbeiterfamilie stammte und von Beruf Metalldrücker war, sondern es wurde auch die von ihm bei seiner Amtseinführung geäußerte „Auffassung über die Polizei im allge- 1063 Vgl. Leßmann-Faust, Die Preußische Schutzpolizei, S. 153ff. 1064 Vgl. o. V., Polizeipräsident Grzesinski, in: ZDPol, 22. Jg. (1925), Nr. 6 (20.6.1925), S. 197. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 291 meinen und über das ihm anvertraute Amt im besonderen“ folgenderma- ßen wiedergegeben: „Objektivität und Unparteilichkeit könne die Bevölkerung verlangen. Das hieße jedoch nicht, es jedem recht machen zu wollen. Alle Amtshandlungen sollen von dem Bewußtsein getragen sein, daß jeder Beamte im Dienst des gesamten Volkes und des Vaterlandes stehe und jederzeit seine volle Pflicht und Schuldigkeit zu tun habe. Im Zweifelsfalle sei von der Polizei immer das Vernünftige zu veranlassen. Die Polizeiorgane hätten mit der Bevölkerung auszukommen und nicht umgekehrt. Jeder Beamte müsse innerhalb seines Wirkungskreises weitestgehende Selbständigkeit haben, doch müsse er sich der Pflichten bewußt sein, die er seinen Vorgesetzten schulde. Besonderen Wert lege er auf eine gute Behandlung der Untergebenen. Nichts sei verwerflicher und schändlicher als die Ausnutzung des Vorgesetztenverhältnisses gegenüber Untergebenen aus politischen, religiösen oder anderen Gründen.“1065 Auch wenn im Beitrag angesichts seiner Kürze keine ausführlichen Analysen zu erwarten waren, so enthielt er aber doch einige sehr wesentliche Aussagen in Bezug auf das vom Präsidenten der mit Abstand größten deutschen Polizeibehörde erwartete Verhalten seiner Polizeibeamten gegenüber der Bevölkerung. Zum einen forderte er eine faire und korrekte Behandlung des Bürgers, wies aber – ähnlich wie auch in der zuvor vorgestellten Hausarbeit aus dem Polizeimajor-Anwärter-Lehrgang 1923 – zugleich darauf hin, dass dies im Polizeialltag Konflikte mit dem Bürger nicht ausschließen dürfte. Die zentrale Aussage seiner Ausführungen war aber sicherlich seine Forderung, die Polizei müsse sich auf die Bedürfnisse des Bürgers einstellen – „und nicht umgekehrt“. Damit drückte Albert Grzesinski seine Vorstellung aus, wie seiner Ansicht nach die Demokratisierung der Polizei und die Annäherung an die Bevölkerung ablaufen müsse. Nicht der Bürger müsse auf die Polizei ‚zugehen‘ und sich an die von ihr gewünschten Umgangsformen anpassen, sondern die Polizei sich nach den Bedürfnissen und Vorstellungen des Bürgers richten. Zugleich dürfte die antithetische Formulierung als verdeckte Kritik an der Polizei gemeint gewesen sein und darauf hindeuten, dass es in der Praxis oftmals eben doch „umgekehrt“ war. Schließlich verlangte er, sich nicht nur im Außenverhältnis gegenüber der Bevölkerung stets fair und korrekt zu verhalten, sondern auch intern im Vorgesetzten-Mitarbeiter-Verhältnis. Dieser Anspruch, der 1065 o. V., Polizeipräsident Grzesinski (20.6.1925), S. 197. IV. Die deutsche Polizei in der Zwischenkriegszeit 292 sich angesichts der expliziten Erwähnung der „Ausnutzung des Vorgesetztenverhältnisses“ eindeutig vor allem an die oberen Hierarchieebenen und damit an das Polizeioffizierskorps richtete und dabei insbesondere die Au- ßerachtlassung der politischen, religiösen oder sonstigen Einstellungen der Belegschaft einforderte, belegte, dass die Demokratisierung der Polizei auch eine interne Dimension hatte. Da diese interne Demokratisierung offensichtlich eine einschränkende Auslegung von zentralen militärischen Werten und Normen wie beispielsweise Disziplin und Gehorsam erforderte, war davon auszugehen, dass sie ein erhebliches Konfliktpotenzial barg. Die hauptsächlich von den sozialdemokratischen preußischen Innenministern Carl Severing und Albert Grzesinski sowie ihres Staatssekretärs Wilhelm Abegg betriebene Demokratisierung der preußischen Polizei hatte nämlich innerhalb der Polizei nicht nur Anhänger, sondern auch zahlreiche Gegner, von denen erheblicher Widerstand gegen diesen politischideologischen Modernisierungsprozess ausging. Dies zeigte sich nicht zuletzt in einer ganzen Reihe von Aufsätzen in der ZDPol, in denen sich eine unübersehbare Tendenz zu einer Verherrlichung militärischer Denk- und Handlungsmuster sowie eine dezidiert kritische Haltung zu Demokratie, Parlamentarismus und der republikanischen Staatsform widerspiegelte. Ein besonders prägnantes Beispiel für diese Art von Publikation war sicherlich der im September 1924 veröffentlichte Aufsatz des Historikers und für seine anti-demokratische Gesinnung bekannten politischen Schriftstellers Oswald Spengler1066 mit dem Titel „Staatsdienst und Persönlichkeit“, der einem im selben Jahr erschienenen Buch dieses Autors entnommen und dessen Nachdruck in der ZDPol von ihm genehmigt worden war.1067 In diesem setzte er sich ausführlich und sehr grundlegend mit den Anforderungen auseinander, die man zweckmäßigerweise an Beamte stellen sollte, und griff dabei u. a. auf historische und international vergleichende Analysen zurück. Dabei ging er von der Annahme aus, dass das Schicksal bzw. der Erfolg eines Volkes davon abhing, dass es „einen leitenden Typus“1068 gab, der dieses Volk prägte und ihm eine Entwicklungsrichtung vorgab. Für das deutsche Volk identifizierte er – mit gewissen Einschränkungen – zwei solcher Typen, nämlich das preußische Beamtentum und den preu- 1066 Vgl. z. B. P. Keßler, Die ‚Neue Rechte‘ in der Grauzone zwischen Rechtsextremismus und Konservativismus? Protagonisten, Programmatik und Positionierungsbewegungen, Berlin u. a. 2018, S. 52ff. 1067 Vgl. O. Spengler, Staatsdienst und Persönlichkeit, in: ZDPol, 21. Jg. (1924/25), Nr. 11 (5.9.1924), S. 276ff. 1068 Spengler, Staatsdienst und Persönlichkeit (5.9.1924), S. 276. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 293 ßisch-deutschen Offizier. In seinem Beitrag ging er zunächst auf den Beamtenstand ein, der kein Beruf sei, sondern ein „Stand“ mit „Standesehre“ und „sittlicher Größe“, der geprägt war durch „Aufopferung für eine Sache“ sowie „harte[n] Dienst, karge Bezahlung, sparsame Anerkennung“ und „gewissenhafteste Leistung“1069. Dann allerdings fügte er einschränkend hinzu: „Wir wollen uns nicht darüber täuschen, daß Revolution und Parlamentarismus auch das vernichtet haben. Seit es Gewerkschaften von Beamten gibt, Parteiminister und den Staat als Versorgungsanstalt für Parteimitglieder, seitdem oft genug nicht die Leistung den Aufstieg bestimmt, sondern der Eifer für eine Partei, fragt man sich nicht mehr, wofür, sondern wovon man lebt, und der Dienst wird bequemer, die Aufsicht lässiger und lästiger, die Arbeit mittelmäßig, und der Rest des Standes löst sich in einem Nachwuchs von Angestellten auf, der jenes Ethos gar nicht mehr kennt.“1070 Oswald Spengler ließ keinerlei Zweifel an seiner anti-demokratischen Grundhaltung aufkommen, indem er den Weimarer Parlamentarismus sehr explizit für die Vernichtung des preußischen Beamtenstandes verantwortlich machte, den er zuvor als einen der beiden wichtigsten Grundpfeiler der deutschen Gesellschaft bezeichnet hatte. Daraus folgt, dass er in der Demokratie eine existenzielle Gefahr nicht nur für das Deutsche Reich, sondern auch für das deutsche Volk sah, denn „[o]hne den Beamten als Stand ist das deutsche Volk nicht denkbar, weder als Rasse noch in seiner gefährlichen Lage“1071. Um den von ihm befürchteten Untergang des deutschen Volkes noch abzuwenden, forderte Oswald Spengler die Vereinigung der beiden von ihn identifizierten ‚leitenden Typen‘ – d. h. Beamtentum und Offizierswesen – und „die Grundgedanken der Erziehung des Heeres durch Moltke auf den künftigen Staatsdienst zu übertragen“1072, wobei er hier den 1891 verstorbenen Generalfeldmarshall Helmuth von Moltke meinte, den er für den ‚Schöpfer‘ des preußisch-deutschen Offizierswesens hielt. Die Übertragung bedeutete für ihn aber keinesfalls nur eine Reform der Ausbildung der Beamten, die sich an militärischen Prinzipen und Werten orientieren sollte, sondern auch den Rückgriff auf ein anderes, besseres „Beamtenmaterial“: 1069 Spengler, Staatsdienst und Persönlichkeit (5.9.1924), S. 277. 1070 Spengler, Staatsdienst und Persönlichkeit (5.9.1924), S. 277. 1071 Spengler, Staatsdienst und Persönlichkeit (5.9.1924), S. 277. 1072 Spengler, Staatsdienst und Persönlichkeit (5.9.1924), S. 278. IV. Die deutsche Polizei in der Zwischenkriegszeit 294 „Für diesen Neubau aber hat sich in aller Stille schon ein neuer deutscher Typus gebildet […]. Es hat in den jungen Freiwilligen von 1914 den ersten prachtvollen Ausdruck gefunden. Diese ‚fixen Jungen‘ […] sind unsere Zukunft […]. Sehr selbständig, Durchgänger, von praktischem Griff, rasch entschlossen, gern mit Verantwortung beladen und allein auf einen Posten gestellt, zu intelligentem Gehorsam bereit, dessen Zweck sie mit einem Blick übersehen, zur Zusammenarbeit fähig nicht durch das Schema einer Dienstverordnung, sondern durch ein instinktives Gefühl dafür, was jetzt kommen muß, sind sie eine Generation, die etwas verspricht. Man findet sie nicht in philosophischen Seminaren und nicht im Literatur- oder Kunstbetrieb. Weltanschauung ist für sie kein Problem und keine Unterhaltung. Sie sind in Masse an der Front gefallen, aber sie wachsen nach, […] klug, stolz, persönlich und innerlich frei, Träger eines deutschen Ethos aus altgermanischer Zeit, das erst jetzt wieder aufgewacht ist als bestes Erbe aus den Jahren des Reichsaufstieges.“1073 Der Autor hatte offensichtlich recht genaue Vorstellungen davon, wie ein deutscher Beamter sein sollte, damit Deutschland wieder eine Zukunft haben konnte, und diese waren unverkennbar von militärischen Denk- und Handlungsmustern geprägt. Im Mittelpunkt standen Charaktermerkmale wie Entschlussfreudigkeit, Gehorsam, Selbständigkeit und Stolz sowie praktische Kenntnisse und Erfahrungen, während Bildung oder theoretisches Wissen sekundär waren und politisch-ideologische oder kulturelle Interessen eher als Störfaktoren gesehen wurden. Unklar blieb, was er mit „deutsche[m] Ethos aus altgermanischer Zeit“ meinte, d. h. ob dies eine im Text nicht näher bestimmte sittliche Gesinnung oder ein Sammelbegriff für die zuvor genannten Persönlichkeitsmerkmale sein sollte. Entscheidend war aber, dass Oswald Spengler in diesem Beitrag für ein Beamtentum – und damit auch für ein Polizeibeamtentum – eintrat, das sich an autoritativen, militärischen Werten und Normen orientieren sollte. Darüber hinaus äußerte er sich äußerst kritisch über die demokratische Grundordnung der Weimarer Republik, in der er eine Gefahr für das deutsche Volk sah. Angesichts der Tatsache, dass diese Publikation in einer von Polizeibeamten herausgegebenen und sich an Polizeibeamte richtenden Zeitschrift erschien, ist davon auszugehen, dass eine solche, mit einer Demokratisierung der Polizei kaum zu vereinbarende Gesinnung in der deutschen Polizei des Jahres 1924 vermutlich weit verbreitet gewesen sein dürfte. 1073 Spengler, Staatsdienst und Persönlichkeit (5.9.1924), S. 278. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 295 Dies veranschaulichte auch ein anderer Beitrag, der im Juli 1926 in der ZDPol vom Polizeimajor Paul Riege publiziert wurde. In diesem Aufsatz mit dem bezeichnenden Titel „Polizist sein – heißt ein ganzer Kerl sein!“ setzte er sich mit den beruflichen Anforderungen an Polizeibeamte auseinander und hielt in Bezug auf das Verhältnis von Polizei und Bevölkerung fest: „‚Die Polizei ist für das Publikum da‘, und ‚der Polizist tut Dienst am Volke‘, diese Lehren haben nicht nur die Bedeutung von Schlagworten, sondern sollen beweisen, wie nötig für den Polizeibeamten auch ein gesundes soziales Verständnis ist. ‚National‘ und ‚sozial‘ sind zwei Dinge, die für jeden vernünftig denken Menschen eigentlich unzertrennlich sein sollten. Wer die ständige Weiterentwicklung der Nation anstrebt, der muß auch wissen, daß diese nur dann möglich ist, wenn alle Volksschichten mit daran arbeiten, wenn eine weitgehende gegenseitige Rücksicht auf die Wünsche und Bedürfnisse aller Kreise des Volkes genommen sind, wenn das komplizierte Räderwerk der Volksgemeinschaft nicht mutwillig gehemmt oder überlastet wird.“1074 Der Autor trat zwar offensichtlich für eine Verbesserung der Beziehungen zwischen der Polizei und dem Bürger ein, allerdings vermied er dabei jegliche Bezugnahme auf mögliche Versäumnisse der Polizei in dieser Hinsicht oder gar demokratische bzw. republikanische Werte und betonte stattdessen die nationale, völkische Dimension dieser Beziehung. Aus dieser Perspektive war folglich keine aktive Annäherung an die Bevölkerung seitens der Polizei erforderlich, sondern vielmehr ein gegenseitiges ‚Aufeinanderzugehen‘, das sich automatisch innerhalb der deutschen Volksgemeinschaft ergeben sollte. Auch wenn er eine direkte, unmissverständliche Kritik am demokratischen System der Weimarer Republik vermied, deutete vor allem der letzte Halbsatz der oben zitierten Passage an, dass seiner Ansicht nach der Weimarer Parlamentarismus wohl maßgeblich dafür verantwortlich war, dass sich „das komplizierte Räderwerk der Volksgemeinschaft“ nicht reibungslos ‚drehte‘. Bemerkenswert war darüber hinaus die vom Autor verwendete Wortwahl („‚national‘ und ‚sozial‘ [... sind …] unzertrennlich“, „gesundes soziales Verständnis“, „Volksgemeinschaft“), aber auch seine Argumentation, die dem weiter unten noch im Detail zu behandelnden Polizeiverständnis des späteren nationalsozialistischen Regimes vorgriffen. Insofern verwundert es nicht, dass Paul Riege später unter der nationalsozia- 1074 P. Riege, ‚Polizist sein – heißt ein ganzer Kerl sein!‘ – Psychologische Betrachtungen, in: ZDPol, 23. Jg. (1926), Nr. 13 (5.7.1926), S. 349 f. IV. Die deutsche Polizei in der Zwischenkriegszeit 296 listischen Herrschaft noch weiter Karriere machen und während des Zweiten Weltkrieges u. a. Befehlshaber der Ordnungspolizei in Böhmen-Mähren werden sollte.1075 Dass seine Vorstellungen, wie die Annäherung von Polizei und Bevölkerung aussehen und wie sich die deutsche Polizei ganz allgemein entwickeln sollte, nichts mit der von der SPD-geführten preußischen Regierung angestrebten Demokratisierung oder Verbürgerlichung der Polizei zu tun hatten, verdeutlichten die folgenden Passagen seines Beitrags: „In den jetzigen Zeiten der innerpolitischen Feindschaft und bei den heute ärger denn je auseinanderstrebenden Volksmeinungen gibt es jedenfalls kein festeres Fundament für den Bestand von Staat und Reich, von Familie und Volk als eine nach erprobten militärischen Grundsätzen aufgebaute Polizei, die mit ihren Wurzeln zwar im Volke steckt, die sich nach außen hin aber als die Verkörperung der Disziplin und des unbedingten Gehorsams gegen die Staatsobrigkeit darstellt. […] Nichts ist schädlicher für die Staatsgewalt als ein Polizeibeamter, der immer nur verhandelt und redet und hin- und herschwankt wie ein Rohr im Winde. Grundsatz ist: Rasche Orientierung, wenn nötig durch kurze präzise Fragen, dann Entschluß und bestimmte klare Anordnungen. Ein willensstarker Polizeibeamter setzt sich immer durch, auch wenn er sich in schwieriger Lage befindet, ein willensschwacher wird zur Karikatur, wenn er auf sich selbst angewiesen ist.“1076 Wie diese Aussagen verdeutlichten, vertrat Paul Riege offenbar ein erzkonservatives Polizeiverständnis, das in der Tradition des preußisch-deutschen Militarismus1077 stand und sich militärisch geprägten Werten wie Disziplin, Gehorsam und Stärke verpflichtet fühlte. Insofern dürfte er als typischer Vertreter des bereits oben angesprochenen, konservativ-monarchistisch orientierten, der republikanischen Staatsform kritisch gegenüberstehenden Polizeioffizierskorps gelten.1078 Wie auch die weiter oben erörterte, im Jahr 1923 entstandene und in der ZDPol veröffentliche Hausarbeit aus dem ersten Polizeimajor-Anwärter-Lehrgang in Berlin schon verdeutlicht hatte1079, sah auch dieser Teil der Polizei die Notwendigkeit und Zweckmä- 1075 Klemp, Nicht ermittelt, S. 60. 1076 Riege, Polizist sein – heißt ein ganzer Kerl sein! (5.7.1926), S. 349. 1077 Vgl. E. Willems, Der preußisch-deutsche Militarismus – Ein Kulturkomplex im sozialen Wandel, Köln 1984. 1078 Vgl. Leßmann-Faust, Die Preußische Schutzpolizei, S. 153ff. 1079 Vgl. o. V., Welche Anforderungen stellen Sie an die Fähigkeiten der Polizeibeamten? (20.6.1924), S. 141ff. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 297 ßigkeit einer Annäherung und vertrauensvollen Zusammenarbeit zwischen Polizei und Bevölkerung, allerdings deuten die in der ZDPol publizierten Beiträge darauf hin, dass das Polizeioffizierskorps diese Annäherung nicht auf der Basis von demokratischen und bürgerlichen, sondern von autoritativen und militärischen Werten und Normen vollziehen wollte. Diese inkompatiblen Grundannahmen verdeutlichte insbesondere die in der zweiten Hälfte dieses Zitats von Paul Riege geäußerte Ablehnung von Verhandlungen oder Diskussionen und die Einforderung von Willensund Durchsetzungsstärke, die sehr deutlich mit der oben bereits erörterten Forderung von Albert Grzesinski, „[d]ie Polizeiorgane hätten mit der Bevölkerung auszukommen und nicht umgekehrt“1080, kontrastierte. Dass eine politisch-ideologische Modernisierung der Polizei im Sinne einer Demokratisierung, wie sie die preußische Landesregierung propagierte, nur schwer umzusetzen sein würde mit einen Polizeioffizierskorps, in dem solche rechtskonservativen Ansichten wohl weit verbreitet waren, ist offensichtlich. Eine wichtige Rolle bei dieser Demokratisierung der Polizei spielten Feierlichkeiten und Ausstellungen, bei denen sich die Polizei der Öffentlichkeit präsentieren und dabei ihre Leistungen und Erfolge herausstellen, ihr äußeres Erscheinungsbild gezielt beeinflussen und je nach Anlass auch bestimmte Werte unmittelbar oder symbolisch vermitteln konnte.1081 Zudem wirkten solche Ausstellungen auch nach innen, indem sie als Instrument der Selbstvergewisserung den inneren Zusammenhalt der Polizei stärkten. Als eine solche Feierlichkeit zählte beispielsweise die Verfassungsfeier der Berliner Schutzpolizei am 11. August 1924 auf dem Berliner Schlossplatz, an der neben dem preußischen Ministerpräsidenten Otto Braun und dem Reichspräsidenten Friedrich Ebert auch zahlreiche weitere Politiker und leitende Polizeibeamte sowie die Öffentlichkeit, die „sich dort zu vielen Tausenden angesammelt hatte“, teilnahmen und über die ein dreiseitiger, mit mehreren Fotografien illustrierter Bericht in der ZDPol erschien, der mit den folgenden Worten begann:1082 „Heiterer Sonnenschein strahlte über Berlin am 11. August, als die Berliner Schutzpolizei die Verfassungsfeier auf dem Schloßplatz be- 1080 o. V., Polizeipräsident Grzesinski, (20.6.1925), S. 197. 1081 Vgl. Leßmann-Faust, Weimarer Republik, S. 39; Bessel, Militarisierung und Modernisierung, S. 328 f.; Jaschke, Geschichte der deutschen Polizei vor und nach 1945, S. 43 f.; Bessel, Policing, S. 195 f. 1082 Vgl. o. V., Die Verfassungsfeier der Berliner Schutzpolizei, in: ZDPol, 21. Jg. (1924/25), Nr. 10 (20.8.1924), S. 239ff. (Zitat: S. 239). IV. Die deutsche Polizei in der Zwischenkriegszeit 298 ging. Mit schwarz-rot-goldenen Fahnen, die man mehr und mehr als eine Schöpfung des wiedererwachenden deutschen Nationalgefühls und keineswegs etwa als ein Produkt des Zusammenbruchs des Deutschen Reiches betrachtet, waren Beleuchtungsmasten, Bäume und Terrassen auf das Reichste geschmückt. Zwischen 9 und 10 Uhr stellten sich die Beamten der Schutzpolizei auf. Mitten auf dem Platz stand eine Musikkapelle, dahinter in dichten Reihen die Hundertschaften. Ein prachtvolles Bild.“1083 Allein schon die Tatsache, dass sowohl die Staatsführung als auch die Polizei einen solchen Aufwand betrieben, um das fünfjährige Bestehen der Weimarer Verfassung zu feiern, stellte zweifelsohne ein an die Bevölkerung gerichtetes, unmissverständliches, symbolträchtiges Zeichen zu Gunsten der demokratischen Grundordnung der Weimarer Republik dar. Zudem diente sie angesichts der gewählten Form einer an militärischen Traditionen anknüpfenden Parade sicherlich auch zur Demonstration von Macht und Stärke. Beide Aspekte wurden in der Folge dann konkretisiert und unterstrichen, indem die beiden Ansprachen des preußischen Ministerpräsidenten sowie des Reichspräsidenten wörtlich wiedergegeben wurden, die erwartungsgemäß die Bedeutung der Weimarer Verfassung, vor allem aber die wichtige Rolle der Polizei bei ihrem Schutz sowohl in den vorausgegangenen, turbulenten Jahren als auch in der Zukunft herausstellten. Dabei wurde eine an die Emotionen und den Stolz der Polizeibeamten appellierende Rhetorik gewählt, die beispielsweise zahlreiche direkte Aufforderungen („Tun Sie, so wie bisher, auch künftig Ihre schwere staatspolitische Pflicht“) und Dankesbekundungen an die anwesenden Beamten, aber auch an diejenigen „die in treuer Pflichterfüllung, in Verteidigung von Gesetz und Verfassung, in den letzten Jahren Leben und Gesundheit gegeben haben“1084, enthielt. Gerade diese stark emotionalisierenden, direkt an die Polizeibeamtenschaft gerichteten Formulierungen verdeutlichten, dass solche öffentlichen Feierlichkeiten nicht nur nach außen – d. h. an die Bevölkerung – gerichtet waren, sondern auch nach innen – d. h. in die Polizei – wirken sollten. Da diese Worte zudem aus dem Munde der höchsten staatlichen Repräsentanten sowohl des Reiches als auch Preußens kamen, dürften sie ihre Wirkung nicht verfehlt haben. Interessant ist darüber hinaus aber auch die Art und Weise, wie der namentlich nicht genannte Autor in diesem Beitrag über diese Verfassungs- 1083 o. V., Die Verfassungsfeier der Berliner Schutzpolizei (20.8.1924), S. 239. 1084 o. V., Die Verfassungsfeier der Berliner Schutzpolizei (20.8.1924), S. 241. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 299 feier berichtete. So war beispielsweise die in der oben zitierten Passage wiedergegebene Interpretation der schwarz-rot-goldenen Fahne eindeutig subjektiv geprägt, nicht durch Fakten gedeckt, politisch ‚gefärbt‘ und stand auch in keinem unmittelbaren Zusammenhang zum Ablauf der Verfassungsfeier, so dass sie offensichtlich auf eine Beeinflussung der im Wesentlichen aus Polizeibeamten bestehenden Leserschaft dieses Beitrags abgezielt haben dürfte. Eine ähnliche Wirkung dürfte auch von den letzten Sätzen dieses Beitrags ausgegangen sein, in denen der Autor bedauerte, dass solche Paraden in Deutschland im Gegensatz zu anderen Ländern ein „ungewohntes Bild“1085 seien. Schließlich ist noch auf die drei im Beitrag enthaltenen Fotografien hinzuweisen, die verschiedene Szenen der Verfassungsfeier darstellten, beispielsweise die in Abbildung 13 abgebildete Fotografie der berittenen Abteilung der Berliner Schutzpolizei, und den Lesern dieser Zeitschrift den militärisch-zeremoniellen Charakter dieser Veranstaltung eindrucksvoll verdeutlichten. Insofern diente die Publikation dieses Beitrags in der ZDPol der Erhöhung der Reichweite der von der Verfassungsfeier ausgehenden Wirkungen, indem sie auch nicht anwesende Polizeibeamte daran teilhaben ließ, und verstärkte auf diese Weise nicht nur ihre Funktion als Instrument der Selbstrepräsentation und Traditionspflege, sondern warb auch aktiv für die Weimarer Verfassung und die demokratische Grundordnung der Republik. Die wichtigste von der Polizei in den mittleren Jahren der Weimarer Republik ausgerichtete öffentliche Veranstaltung war aber sicherlich die ‚Gro- ße Polizeiausstellung‘, die im Spätsommer 1926 in Berlin stattfand, an der sich Polizeien aus 29 Ländern beteiligten und die fast eine halbe Million Besucher anzog.1086 Hier konnte die deutsche Polizei sehr publikumswirksam ihr modernes, demokratisches ‚Gesicht‘ zeigen und sich präsentieren als „a professional crime-fighting and order-preserving organ of the state, […] an up-to-date organisation enthusiastically embracing new technology, […] a force dedicated to upholding the rule of law and developing a close and trusting relationship with the citizens whose duty it was to protect“1087. In der ZDPol wurde die Große Polizeiausstellung in einer ganzen Reihe Beiträgen, die insbesondere in den zwei Ende September und Anfang Oktober 1926 herausgegebenen Sonderheften zur Ausstellung enthalten waren, sehr intensiv behandelt. Den Anfang machte allerdings ein kurzer Aufsatz des Ministerialdirektors und späteren Staatssekretärs im Preußi- 1085 o. V., Die Verfassungsfeier der Berliner Schutzpolizei (20.8.1924), S. 241. 1086 Vgl. Bessel, Policing, S. 187 f.; Spieker, Passer à l’Acte, S. 150ff. 1087 Bessel, Policing, S. 188. IV. Die deutsche Polizei in der Zwischenkriegszeit 300 schen Innenministerium Wilhelm Abegg, der bereits im November 1925 erschien und die für das darauf folgende Jahr geplante Ausstellung ankündigte.1088 Interessant war dieser Beitrag vor allem, weil er zu Beginn die Gründe erläuterte, warum die preußische Polizei diese Ausstellung veranstaltete. Dabei wies der Autor zunächst auf die Notwendigkeit der engeren Zusammenarbeit mit den anderen deutschen und ausländischen Polizeien hin, bevor er anmerkte: „Gerade die weite Öffentlichkeit bedarf auf dem Gebiete des Polizeiwesens zum Zwecke des eigenen Schutzes wie auch der gebotenen Zusammenarbeit mit den Polizeibehörden einer umfassenden Aufklärung und Anregung. […] Während in den Zeiten des alten Polizeistaates die Bevölkerung bei einem polizeilichen Einschreiten gegen die Polizeibeamten Stellung zu nehmen pflegte, muß in der heutigen Zeit mit allen Mitteln danach gestrebt werden, eine polizeifeindliche Einstellung des Publikums zu beseitigen und die Erkenntnis Allgemeingut werden zu lassen, daß die moderne Polizei nicht nur der berufene Hüter der bestehenden Staatsform, sondern auch der jederzeit bereite 1088 Vgl. W. Abegg, Die Große Polizeiausstellung Berlin 1926, in: ZDPol, 22. Jg. (1925), Nr. 15 (5.11.1925), S. 415 f. Verfassungsfeier der Berliner Schutzpolizei 1924 (Quelle: ZDPol, 21. Jg. (1924/25), Nr. 10 (20.8.1924), S. 239) Abb. 13: 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 301 Helfer und Schützer des Publikums ist. Aus diesen Gründen beabsichtigt der Preußische Minister des Innern im Einvernehmen mit dem Preußischen Finanzminister, im Jahre 1926 in Berlin eine Polizeikonferenz, verbunden mit einer ‚Großen Polizeiausstellung‘, zu veranstalten.“1089 Wie man diesen Ausführungen entnehmen konnte, war die Große Polizeiausstellung von 1926 von Anfang an explizit als Instrument zur Verbesserung der Beziehungen zwischen der Polizei und der Bevölkerung geplant. Auch wenn hier die „polizeifeindliche Einstellung des Publikums“ in die „Zeiten des alten Polizeistaates“ datiert wurde, so deutete doch der ebenfalls deutlich ausgesprochene Handlungsbedarf darauf hin, dass diese Phase noch nicht überwunden war und eine Annäherung zwischen Polizei und Bürger auch im Jahr 1926 weiterhin geboten war. Bemerkenswert war sicherlich auch der Hinweis auf die offensichtlich vorliegende Genehmigung des Finanzministeriums, der im Kontext eines solchen Beitrags in einer polizeilichen Fachzeitschrift verzichtbar erscheint, dessen explizite Erwähnung aber auf die bereits weiter oben mehrmals thematisierten, schwierigen fiskalischen Rahmenbedingungen in den mittleren Jahren der Weimarer Republik und die sich daraus ergebende Finanzmittelknappheit der Polizei verwies. Die Tatsache, dass die Große Polizeiausstellung von 1926 trotz der sicherlich erheblichen finanziellen Mehrbelastungen des Haushalts durchgeführt wurde, unterstrich die zentrale Bedeutung, die die politischen Entscheidungsträger der Demokratisierung der Polizei und ihrer ‚Öffnung‘ gegenüber der Bevölkerung beimaßen. Gerade diese ‚Öffnung‘ thematisierte der preußische Innenminister Carl Severing in seinem Geleitwort zur im September 1926 anlässlich der Gro- ßen Polizeiausstellung erschienenen Sonderausgabe der ZDPol.1090 Auch wenn sich die von ihm in diesem Geleitwort wiedergegebene Erklärung des Zwecks der Ausstellung größtenteils sehr stark an der bereits oben vorgestellten Begründung seines Mitarbeiters Wilhelm Abegg orientierte und dementsprechend die Verbesserung der Beziehungen zwischen der Polizei und der Bevölkerung sowie die Rolle der Polizei als ‚Freund und Helfer‘ des Bürgers in den Mittelpunkt stellte, so unterschied sie sich doch in einem Punkt – und zwar in der besonderen Hervorhebung der Notwendigkeit einer ‚Öffnung‘ der Polizei gegenüber der Öffentlichkeit: 1089 Abegg, Die Große Polizeiausstellung Berlin 1926 (5.11.1925), S. 415. 1090 Vgl. C. Severing, Die Große Polizeiausstellung Berlin 1926 – Ein Geleitwort, in: ZDPol, 23. Jg. (1926), Nr. 18 (20.9.1926), S. 451 f. IV. Die deutsche Polizei in der Zwischenkriegszeit 302 „Das Wesentliche scheint mir zu sein, daß die Ausstellung eine Brücke zur Erkenntnis des Publikums von der Wesenheit und Notwendigkeit der Polizei, ihren Aufgaben und ihrem Wirken schlagen will, die die unumgängliche Voraussetzung für eine gedeihliche Betätigung der Polizei bedeutet. […] Nicht gegen die Bürger, sondern für diese will sie arbeiten. Wenn in den nicht so weit zurückliegenden Zeiten ihre Tätigkeit wenig bekannt war, wenn sie volksfremd sich auf sich selbst verließ und aus ihrer Betätigung vielfach ein Geheimnis machte, so hat sich die Polizei heute zur Aufgabe gestellt, in aller Öffentlichkeit ihres schweren Amtes zu walten. […] Durch Verständnis zum Verstehen, das ist der Sinn der großen Ausstellung, und diesem Grundgedanken sind auch die öffentlichen Vorträge angepasst.“1091 Dabei stach zunächst vor allem der bis in den heutigen Tag hinein aus polizeilicher Sicht zentrale Leitsatz hervor, dass erfolgreiche Polizeiarbeit nur möglich ist, wenn die Polizei bei der Bewältigung ihrer Aufgaben auf die Unterstützung der Bevölkerung bauen kann. Die darin enthaltene herrschaftssoziologische Erkenntnis der Begrenztheit staatlicher Machtaus- übung und der Notwendigkeit der Akzeptanz des staatlichen Machtanspruchs durch die Bevölkerung, wie sie sechs Jahrzehnte später insbesondere in Alf Lüdtkes Ansatz von staatlicher Herrschaft als sozialer Praxis sowie dem soziologisch geprägten Stufenmodell von staatlicher Herrschaft von Heinrich Popitz postuliert werden würden1092, hatte Carl Severing offensichtlich bereits damals erfasst und seiner Politik zu Grunde gelegt. Im Ergebnis führte diese Erkenntnis nahezu zwangsläufig zu der Forderung nach einer ‚Öffnung‘ der Polizei gegenüber der Öffentlichkeit, um auf diese Weise das für eine erfolgreiche Polizeiarbeit erforderliche Vertrauen bei der Bevölkerung aufzubauen. Die Anfang Oktober 1926 erschienene Sonderausgabe zur Großen Polizeiausstellung der ZDPol enthielt neben einigen weiteren Beiträgen zu Einzelthemen einen relativ ausführlichen, einleitenden Überblicksaufsatz, in welchem der Polizeirat Edmund Paczkowski zunächst den Ablauf der Eröffnungsfeier am 25. September 1926 zusammenfasste und dann einen groben thematischen und räumlichen Überblick über die Ausstellung gab.1093 Die Eröffnungsfeier bestand im Wesentlichen aus drei Reden des 1091 Vgl. Severing, Die Große Polizeiausstellung Berlin (20.9.1926), S. 451. 1092 Vgl. Lüdtke, Einleitung: Herrschaft als soziale Praxis, S. 13ff.; Popitz, Phänomene der Macht, S. 64ff. 1093 Vgl. E. Paczkowski, Die Große Polizeiausstellung Berlin 1926, in: ZDPol, 23. Jg. (1926), Nr. 19 (5.10.1926), S. 523ff. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 303 preußischen Innenministers Carl Severing, seines Ministerialdirektors Wilhelm Abegg und des Berliner Oberbürgermeisters Gustav Böß, in denen diese kurz den Sinn und Zweck der Ausstellung erläuterten und dabei Positionen vortrugen, die bereits oben in den letzten beiden zitierten Beiträgen behandelt wurden. So wiederholte Carl Severing, dass die Ausstellung neben dem internationalen Austausch mit ausländischen Polizeien insbesondere dem Aufbau von Vertrauen diene, da „die Polizei ihre nach der Staatsumwälzung wesentlich größeren Aufgaben [selbstverständlich] nur erfüllen [könne], wenn sie das Vertrauen des gesamten Volkes habe“1094, während Wilhelm Abegg „besonders eindringlich darauf hin[wies], daß der Zweck der Polizeiausstellung auch der sei, ein einiges, auf Verständnis und Achtung beruhendes Verhältnis zwischen Bevölkerung und Polizei herzustellen“1095. Und auch der Oberbürgermeister Gustav Böß vertrat eine ähnliche Auffassung, als er die Polizei in seiner Rede als „Teil des Volkes“ und „Freund des Publikums […], der mit den Bürgern arbeiten wolle, damit sie ruhig ihren Geschäften nachgehen könnten“1096, charakterisierte. Anschließend eröffnete der preußische Ministerpräsident Otto Braun die Große Polizeiausstellung, und es folgte ein Rundgang über das Ausstellungsgelände, das u. a. eine repräsentativen Zwecken dienende Ehrenhalle, die insbesondere die Stände der ausländischen Polizeien enthielt, separate Hallen für die Verwaltungspolizei, die uniformierte Polizei inklusive der Landjäger und der stark vertretenen Verkehrspolizei sowie die Kriminalpolizei und ein Polizeimuseum umfasste. Daneben fanden noch verschiedene Tagungen, Fachvorträge, Filmvorführungen und Wettbewerbe sowie „volkstümliche Vorträge […], deren Ziel die Aufklärung des Publikums über Wesen, Wirken und Notwendigkeit der Polizei ist“1097, statt. Der Überblicksaufsatz endete mit den folgenden Worten: „Damit ist alles getan, um den Besuchern einen vollen Einblick in die Organisation und die Arbeitsweise unserer Polizei zu gewähren und dazu beizutragen, daß die Erkenntnis von dem wirklichen Wesen und Wert der Polizei in weiteste Kreise dringt und dadurch ein festes Vertrauensverhältnis zwischen Polizei und Publikum angebahnt und weiter ausgebaut wird. Möge die Große Polizeiausstellung Berlin 1926 die 1094 Paczkowski, Die Große Polizeiausstellung Berlin 1926 (5.10.1926), S. 523. 1095 Paczkowski, Die Große Polizeiausstellung Berlin 1926 (5.10.1926), S. 524. 1096 Paczkowski, Die Große Polizeiausstellung Berlin 1926 (5.10.1926), S. 524. 1097 Paczkowski, Die Große Polizeiausstellung Berlin 1926 (5.10.1926), S. 526. IV. Die deutsche Polizei in der Zwischenkriegszeit 304 Ziele, die sie sich gesteckt hat, in vollem Umfange erreichen zum Wohle der Polizeibeamtenschaft und unseres gesamten Volkes.“1098 Um zu überprüfen, ob diese Ziele tatsächlich erreicht wurden und die Große Polizeiausstellung wirklich zu einer Annäherung zwischen Polizei und Bevölkerung beitrug, wäre eine systematische Evaluation erforderlich gewesen, die aber erwartungsgemäß unterblieb. Gleichwohl erschien Ende Oktober 1926 in der ZDPol ein Beitrag des stellvertretenden Kommandeurs der Berliner Schutzpolizei, Polizeioberst Magnus Heimannsberg, dessen Titel „Hat die Polizei-Ausstellung ihren Zweck erreicht?“ lautete.1099 In diesem mit vier Seiten relativ ausführlichen Beitrag gab der Autor seine subjektive Einschätzung zum Erfolg der Großen Polizeiausstellung ab, die insgesamt sehr positiv ausfiel. Sein Beitrag enthielt zwar auch Kritik, z. B. an der thematischen Breite und der nicht immer nachvollziehbaren, teilweise redundanten Struktur der Ausstellung, allerdings überwogen die positiven Urteile sehr eindeutig. Zahlreiche seiner Einschätzungen hatten den Charakter von unbewiesenen und auch nicht beweisbaren Behauptungen (z. B. „Äußerungen von Besuchern ließen erkennen, daß man die Polizeibeamtenschaft nicht mehr als Fremdkörper betrachtet“1100), so dass man sie lediglich als subjektive Einzelmeinung betrachten sollte und sich eine Verallgemeinerung verbietet. Der Beitrag enthielt aber auch Passagen wie die folgende, die etwas belastbarer bzw. glaubwürdiger wirkten, da sie zumindest ansatzweise Bezug auf grundsätzlich nachprüfbare Fakten nahmen. „Nicht eine Stimme bisher aus Fachkreisen des In- und Auslandes, die nicht uneingeschränktes Lob spendet, die nicht zugesteht, daß hier Großes geleistet ist in der Darstellung von Stand und Fortentwicklung der Polizeiwissenschaft […]. Und das Publikum? Hat es kein Interesse gezeigt? […] Zeigen nicht zahllose Presseauslassungen immer wieder mit Genugtuung als wesentlichsten Erfolg der Ausstellung, daß man es verstanden hat, in der Bevölkerung Verständnis zu wecken und zu beleben für den schweren Dienst des Polizeibeamten und dafür, daß er weit mehr Freund, Helfer, Berater ist, als das verhaßte Organ rächender oder schikanierender Staatsgewalt? Sprechen nicht die vom Eröff- 1098 Paczkowski, Die Große Polizeiausstellung Berlin 1926 (5.10.1926), S. 526. 1099 Vgl. M. Heimannsberg, Hat die Polizei-Ausstellung ihren Zweck erreicht? in: ZDPol, 23. Jg. (1926), Nr. 20 (20.10.1926), S. 576ff. 1100 Heimannsberg, Hat die Polizei-Ausstellung ihren Zweck erreicht? (20.10.1926), S. 578. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 305 nungstag an wachsenden Besucherzahlen für weitgehendes Interesse des Publikums? Der Sonntag des 3. Oktobers sah bis 7 Uhr abends allein über 50.000 Besucher!“1101 Magnus Heimannsberg bezog sich hier – und auch an anderen Stellen („Sprechen doch einzelne Zeitungen von ‚unübersehbaren Menschenmassen‘“) – auf die Rezeption der Großen Polizeiausstellung in der Presse sowie auf die Reaktionen der polizeilichen Fachwelt. Da ein Großteil des aus interessierten Polizeibeamten bestehenden Leserkreises der ZDPol vermutlich in der Lage war, den Wahrheitsgehalt dieser Aussagen einzuschätzen, riskierte der Autor im Falle einer falschen Behauptung eine Blamage und eine Beschädigung seiner Reputation im Fachkollegenkreis. Dies dürfte auch für die von ihm angesprochenen Besucherzahlen gelten, die vermutlich ebenfalls bereits in der Presse thematisiert worden waren. Insofern dürften die hier von ihm geäußerten Einschätzungen tendenziell zutreffend oder zumindest nicht völlig abwegig gewesen sein. Angesichts der hier genannten Besucherzahlen und der eingeschränkten Mobilität insbesondere der unteren Bevölkerungsschichten in mittleren Jahren der Weimarer Republik ist jedoch nicht davon auszugehen, dass die Große Polizeiausstellung über den Großraum Berlin hinaus signifikante Wirkungen in der deutschen Bevölkerung entfalten konnte. Eine zuverlässige Einschätzung der öffentlichen Wahrnehmung dieser Ausstellung durch die Bevölkerung allein auf der Grundlage dieses in einer polizeilichen Fachzeitschrift erschienenen Beitrags ist aber ohnehin nicht möglich. Dies gilt allerdings nicht für die Wahrnehmung der Ausstellung durch die Polizei, die ja ganz wesentlich durch eben solche Publikationen geprägt wurde und für die gerade der Autor dieses Beitrags, Magnus Heimannsberg, der aus einfachen Verhältnissen stammte, in der Belegschaft sehr beliebt und durchaus republikanisch gesinnt war und daher als „Prototyp des zukünftigen ‚Volksoffiziers‘“ galt und der 1927 sogar zum Kommandeur der Berliner Schutzpolizei aufsteigen sollte1102, sehr wohl als belastbare Quelle gelten muss. Dementsprechend dürfte seine abschließende, äußerst positive Gesamteinschätzung, die an das von Carl Severing im Vorfeld der Ausstellung vorgegebene Motto anknüpfte, eine recht gute Annäherung an die Wahrnehmung von Sinn und Zweck sowie des Erfolges 1101 Heimannsberg, Hat die Polizei-Ausstellung ihren Zweck erreicht? (20.10.1926), S. 577. 1102 Vgl. Liang, Die Berliner Polizei, S. 176ff. (Zitat: S. 176). IV. Die deutsche Polizei in der Zwischenkriegszeit 306 der Großen Polizeiausstellung durch die deutsche Polizei dargestellt haben: „‚Durch Verständnis zum Verstehen‘! Das war das Geleitwort, das der Preußische Innenminister der Polizeiausstellung mit auf dem Weg gegeben hat. Ich glaube, daß dieses Wort sich in seinem ganzen Sinne erfüllt hat, daß Vertrauen für die Polizei und ihre Arbeit geworben ist wie nie zuvor. […] So dürfen wir als Veranstalter, frei von jeder Selbst- überhebung, die Gewißheit mit uns nehmen, daß wir in unserm Wollen auf der Ausstellung verstanden sind, daß die große Arbeit und Mühe nicht umsonst gewesen ist. Ein wichtiger Schritt zur Vertiefung des Gedankens wahrer Volksgemeinschaft ist getan.“1103 Insgesamt ist daher davon auszugehen, dass die Große Polizeiausstellung von 1926 sicherlich zur Demokratisierung der Polizei betrug – und zwar im Sinne einer weiteren Öffnung der Polizei für die Öffentlichkeit, die zu einer vertrauensvolleren Beziehung zwischen Polizei und Bürger geführt haben dürfte. Neben dieser externen Dimension der Demokratisierung gab es aber auch eine interne, die im Kontext von solchen Feierlichkeiten oder Ausstellungen weniger relevant war und vor allem das Vorgesetzten-Mitarbeiter- Verhältnis betraf. Dieses war in der Polizei in den mittleren Jahren der Weimarer Republik weiterhin von militärischen Werten wie Gehorsam und Disziplin geprägt, die auf einen Großteil der Bevölkerung und sicherlich auch der Polizei nicht mehr zeitgemäß wirkten und nicht uneingeschränkt mit der damals geltenden demokratischen Grundordnung zu vereinbaren waren. Diese Thematik wurde in der bereits weiter oben schon einmal zitierten Rede des Leiters der Polizeiabteilung im Preußischen Innenministerium, Erich Klausener, auf der 7. Preußischen Polizeiwoche in Köln ausführlich behandelt. In dieser Rede, die sich mit den wichtigsten tagespolitischen Fragen der Polizei beschäftigte und im Juni und Juli 1928 in zwei Teilen in der ZDPol erschien, merkte er hierzu an: „Der neue Staat hat neue Ideen gebracht. Wir müssen uns immer wieder ernsthaft fragen, ob diese neuen Ideen bereits Gemeingut aller Polizeibeamten geworden sind! […] Ich habe den Eindruck, daß viele Schwierigkeiten, die heutzutage noch entstehen und Anlaß zu häßlichem Streit geben, nur darauf beruhen, daß man nicht weiß, wie man 1103 Heimannsberg, Hat die Polizei-Ausstellung ihren Zweck erreicht? (20.10.1926), S. 580. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 307 die neue Form und den neuen Geist mit alter Tradition in Einklang bringen soll. […] Wir werden uns als Vorgesetzte darüber klar sein müssen, daß in der alten Zeit der Schwerpunkt im Befehl, der Anordnung lag. Es gab Untergebene, bei denen man einen kritiklosen Gehorsam voraussetzte […]. Man fragte nicht nach der Meinung des Untergebenen, da man von ihm ja nur den Gehorsam erwartete. […] Heute ist die Volkssouveränität der Grundstein der Verfassung. Der Beamte ist nicht nur ein freier Staatsbürger, sondern auch ein freier Beamter. Er hat die politische und gewerkschaftliche Freiheit erhalten, er hat das Recht zur Mitarbeit dadurch in einem ganz anderen Ausmaß erworben und im Rahmen dieser Mitarbeit auch ein Recht zur Kritik.“1104 Zu Beginn nahm er eine unmissverständliche Kritik am in der Polizei vorherrschenden Führungsverständnis und damit insbesondere am Polizeioffizierskorps vor, die hier nur auszugsweise wiedergegeben wird und im Original ausführlicher und damit auch noch deutlicher ausfiel. Das Ergebnis dieser Diagnose war das Eingeständnis, dass die von der preußischen Landesregierung verfolgte Demokratisierung der Verwaltung zumindest in der Polizei und zumindest in Bezug auf ihre interne Dimension bis zum Jahr 1928 wenig erfolgreich gewesen war. Fast zehn Jahre nach der Revolution von 1918 war es in der deutschen Polizei offenbar noch üblich und angebracht, die Weimarer Republik als ‚neuen Staat‘ und ihre demokratische Grundordnung als ‚neue Ideen‘ und ‚neuen Geist‘ zu bezeichnen, die im polizeilichen Innenverhältnis immer noch ‚viele Schwierigkeiten‘ und ‚häßlichen Streit‘ erzeugten. Gerade die Hinweise auf das auch den Mitarbeitern unterer Hierarchieebenen zustehende ‚Recht zur Kritik‘ sowie auf die Notwendigkeit, dass „der Wert der Menschenwürde in dem Verhältnis der Menschen untereinander ohne Rücksicht auf Rang und Stand stärker betont wird“1105, verdeutlichten, dass in den oberen Führungsebenen der Polizei die auf Partizipation und Mitbestimmung abzielenden, demokratischen Werte und Normen sowie die entsprechenden Bürgerrechte zumindest im Führungshandeln weiterhin alles andere als selbstverständlich waren. Der Autor hielt es daher für angebracht, zumindest ansatzweise zu erklären, was er als nicht mehr zeitgemäßes und daher unzweckmäßiges Führungsverständnis („Herrenmenschentum“) ansah und wie ein modernes Führungsverständnis („Führertum“) auszusehen habe: 1104 Klausener, Tagesfragen der Polizei (5.7.1928), S. 404 f. 1105 Klausener, Tagesfragen der Polizei (5.7.1928), S. 405. IV. Die deutsche Polizei in der Zwischenkriegszeit 308 „Mir scheint, es wird nicht genügend unterschieden zwischen ‚Herrenmenschentum‘ und ‚Führertum‘. [...] Herrenmenschentum will befehlen, will Jasager, will krumme Rücken unter sich sehen. Führer wollen Führer nicht auf Grund ihrer Stellung, sondern auf Grund des Gehorsams und der Gefolgschaft sein, die ihnen freiwillig entgegengebracht werden, sie wollen in offene Augen von Männern sehen, die auch zu widersprechen wagen. […] Ich habe den Eindruck, dass nicht unterschieden wird zwischen dem Geiste gewollter Unterordnung unter den Führer und einem servilen Knechtsgeist, der hintenherum redet und stänkert, nach oben aber schön tut, der es aber nicht wagt, offen sein Wort zu führen, und daß der Begriff ‚Disziplin‘ nicht klar erkannt wird. Disziplin ist nicht Strammstehen und Hackenzusammenschlagen, Disziplin ist: aufrecht dem Vorgesetzten ins Auge sehen und eine abweichende Meinung äußern können, aber wenn der Vorgesetzte in Kenntnis dieser Meinung einen entgegengesetzten Beschluß faßt oder eine entgegengesetzte Anordnung getroffen hat: Gehorchen können bis in die letzte Konsequenz!“1106 Erich Klausener machte sein vehementes Eintreten für ein modernes, an demokratischen Prinzipen orientiertes Führungsverständnis aber nicht nur an der veränderten Staatsform fest, vielmehr versuchte er auch zu erläutern, warum ‚Herrenmenschentum‘ bzw. ein ausschließlich auf Befehl und Gehorsam basierender Führungsstil sich negativ auf das Organisationsklima und letztlich auch auf die Motivation der Belegschaft auswirken würde. Dabei zeigte seine pejorative Verwendung von militärisch geprägten Begriffen („Strammstehen und Hackenzusammenschlagen“), dass sich diese Kritik vor allem an die als rechtskonservativ und antirepublikanisch geltenden, militärerfahrenen und meistens noch in der Kaiserzeit in den Polizeidienst eingetretenen Polizeioffiziere richtete. Der Autor bezog zwar auch die unteren Hierarchieebenen der Polizei in seine Kritik ein, insbesondere als er festhielt, „daß Freiheit nicht schrankenlose, zersetzende Kritik, schrankenlose Beseitigung aller Vorgesetzten bedeutet, sondern daß Freiheit ohne Ordnung mit Befehlsgewalt und Gehorsamspflicht nicht bestehen kann“1107, allerdings wurde aus dem Gesamtkontext deutlich, dass er vor allem die Führungsebene bzw. das Polizeioffizierskorps in der Pflicht sah, zu einer Verbesserung der offensichtlich schlechten Vorgesetzten-Mitarbeiter-Beziehungen in der Polizei beizutragen. 1106 Klausener, Tagesfragen der Polizei (5.7.1928), S. 405. 1107 Klausener, Tagesfragen der Polizei (5.7.1928), S. 405. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 309 Zusammenfassend lässt sich folglich festhalten, dass die in der ZDPol veröffentlichten Beiträge darauf hindeuteten, dass in den mittleren Jahren der Weimarer Republik enorme Anstrengungen von Seiten des preußischen Innenministeriums unternommen wurden, um eine Demokratisierung der Polizei ‚von oben‘ zu erreichen. Diese Bemühungen dürften im Außenverhältnis nicht ohne Folgen geblieben sein und eine Öffnung der Polizei gegenüber der Öffentlichkeit sowie – zumindest in den mittleren und oberen Bevölkerungsschichten in urbanen Räumen – eine gewisse Annäherung an den Bürger bewirkt haben. Im Innenverhältnis ist der Erfolg dieser Bemühungen hingegen deutlich skeptischer einzuschätzen, da man kaum Anhaltspunkte für eine dauerhafte Verankerung von demokratischen Werten und Leitbildern in der Organisations- und Führungskultur der Polizei findet. Insgesamt kommt Christian Knatz daher zu dem Ergebnis, dass man angesichts der mangelnden Anpassung des polizeilichen Selbstverständnisses an die gesellschaftlichen und politischen Rahmenbedingungen der Weimarer Republik weniger von einer echten Modernisierung der Polizei in Sinne einer Demokratisierung als von „einer Optimierung des Überkommenen“1108 sprechen sollte. Reform des Ausbildungswesens Eine zentrale Maßnahme zur Modernisierung, insbesondere aber zur Professionalisierung der Polizei in den mittleren Jahren der Weimarer Republik war sicherlich die Neugestaltung des polizeilichen Ausbildungswesens. Dieses hatte bis zum Ende des Ersten Weltkriegs nur in rudimentärer Form existiert, wies nicht nur zwischen den, sondern auch innerhalb der Bundesländer große Unterschiede auf und fehlte in manchen Regionen sogar gänzlich.1109 Der Leiter der Polizeischule in Hildesheim, Ludwig Bartels, stellte in einem in der ZDPol im März 1924 veröffentlichten Beitrag mit dem Titel „Die Polizeischule in Vergangenheit, Gegenwart und Zukunft“ daher in Bezug auf die Ausbildung von Polizeibeamten in Wilhelminischen Deutschland fest: „Es war also ein zahlenmäßig nur recht geringer Bruchteil der Beamten der Vollzugspolizei, welcher des Vorteils einer planmäßigen Fache) 1108 Knatz, Polizei in der Weimarer Republik, S. 52. 1109 Vgl. Bessel, Policing, S. 198; Knatz, Polizei in der Weimarer Republik, S. 49; Leßmann-Faust, Die Preußische Schutzpolizei, S. 193ff. IV. Die deutsche Polizei in der Zwischenkriegszeit 310 ausbildung auf einer eigens diesem Zwecke dienenden Anstalt teilhaftig wurde. Die große Mehrzahl der neu eingestellten Beamten mußte nach wie vor vom ersten Tage an praktischen Dienst versehen und wurde nur neben dieser besonders im Anfange körperlich und geistig gleichmäßig ermüdenden Tätigkeit durch Unterricht und praktische Anleitung […] nur recht unzulänglich und vor allen Dingen erst viel zu spät mit den für ihr Amt erforderlichen und unentbehrlichen Kenntnissen ausgerüstet.“1110 Um diesen unbefriedigenden Zustand zu verbessern, wurde ab 1921 im Zuge einer reichsweiten Neugestaltung und Vereinheitlichung der Polizeiausbildung ein Netz an Polizeischulen und Polizeiberufsschulen eröffnet, an denen die neu eingestellten Polizeianwärter ihre Aus- und Fortbildung absolvieren konnten und an dessen Spitze die für die Offiziersausbildung zuständige ‚Höhere Polizeischule‘ in Eiche bei Potsdam stand.1111 Hinzu kam ab Oktober 1927 das Preußische Polizei-Institut in Charlottenburg, das als zentrale Bildungs- und Forschungseinrichtung für die gesamte Polizei dienen und zum „Motor der Modernisierung“ der Polizei werden sollte, das aber letztlich keine nachhaltige Wirkung auf die Polizeiarbeit in der Weimarer Republik entfalten sollte.1112 Die Schlüsselrolle bei der Professionalisierung und Modernisierung des polizeilichen Ausbildungssystems der Weimarer Republik Mitte der 1920er Jahre spielten zweifelsohne die für die Ausbildung des Polizeinachwuchses zuständigen Polizeischulen und Polizeiberufsschulen. An den Polizeiberufsschulen wurden allgemeinbildende Inhalte vermittelt, während die Polizeischulen für die Vermittlung polizeifachlicher und rechtlicher Kenntnisse sowie insbesondere für die Körperschulung und die Waffenausbildung zuständig waren.1113 In den ersten Jahren nach ihrer Gründung bestand die Hauptaufgabe dieser Einrichtungen allerdings zunächst in der ‚Nachschulung‘ der bereits eingestellten Polizeibeamten bzw. der so genannten „Übergangs-Anwärter“ im Rahmen von „abgekürzten Lehrgängen“, um den hohen Einstellungsbe- 1110 L. Bartels, Die Polizeischule in der Vergangenheit, Gegenwart und Zukunft, in: ZDPol, 20. Jg. (1923/24), Nr. 23 (5.3.1924), S. 396. 1111 Vgl. Knatz, Polizei in der Weimarer Republik, S. 49 f.; Leßmann-Faust, Die Preußische Schutzpolizei, S. 195ff.; Buder, Die Reorganisation der preußischen Polizei, S. 521ff.; Zaika, Polizeigeschichte, S. 62ff. 1112 Vgl. Knatz, Polizei in der Weimarer Republik, S. 52 f. (Zitat: S. 52); Zaika, Polizeigeschichte, S. 60ff. 1113 Vgl. H. Degenhardt, Das Polizeibildungswesen, in: ZDPol, 23. Jg. (1926), Nr. 23 (5.12.1926), S. 669ff. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 311 darf an Polizeikräften in den ersten Nachkriegsjahren abdecken zu können, auch wenn es sich hier nur um eine aus fachlicher Sicht unbefriedigende Übergangslösung handelte, die Ludwig Bartels als zeitlich begrenztes, „unvermeidliches Übel“1114 bezeichnete. Die reguläre, einjährige Ausbildung der Polizeianwärter erfolgte parallel an den Polizeischulen und den Polizeiberufsschulen und umfasste neben physischen Übungen und Schießtraining auch theoretisch-allgemeinbildende Inhalte aus Bereichen wie Recht, Geographie, Sprache, Politik und Geschichte.1115 Darüber hinaus boten die Polizeischulen einen viermonatigen Lehrgang für Oberwachtmeister-Anwärter an, der sich an Beamte richtete, die bereits zwischen vier und sechs Jahren in der kasernierten Bereitschaftspolizei gearbeitet hatten und nun eine Führungsfunktion übernehmen oder in der Ausbildung eingesetzt werden sollten.1116 Auch wenn dies im Vergleich zu der früheren Situation eine gewaltige Verbesserung der Ausbildung bedeutete, so sind durchaus Zweifel angebracht, ob das neue Ausbildungssystem tatsächlich signifikant dazu beitrug, die Polizei zu einer modernen und professionellen Organisation zu entwickeln.1117 Ursächlich hierfür war vor allem, dass trotz des durchaus breiten Fächerkanons während der Ausbildung der Schwerpunkt sehr eindeutig im militärtaktischen Bereich lag, so dass die Ausbildungsinhalte weniger auf die Belange des polizeilichen Streifendienstes als vielmehr auf diejenigen der für die Niederschlagung von größeren Unruhen und Aufständen zuständigen geschlossenen Polizeiverbände ausgerichtet waren.1118 Dementsprechend machten militärischer Drill, ‚Exerzierdienst‘ und Waffenappelle den weitaus größten Teil der polizeilichen Ausbildung aus, was wiederum für eine nicht unerhebliche Abbrecherquote unter den Polizei- und Oberwachtmeisteranwärtern verantwortlich war.1119 Ludwig Bartels sah in der militärischen Prägung der polizeilichen Ausbildung allerdings kein Problem, sondern eher eine Stärke, wie die folgende Passage verdeutlicht: 1114 Bartels, Die Polizeischule (5.3.1924), S. 397. 1115 Vgl. Siggemann, Die kasernierte Polizei, S. 185ff.; Bessel, Policing, S. 198; Leßmann-Faust, Die Preußische Schutzpolizei, S. 197. 1116 Vgl. Liang, Die Berliner Polizei, S. 62. 1117 Vgl. Bessel, Militarisierung und Modernisierung, S. 338 f. 1118 Vgl. Leßmann-Faust, Die Preußische Schutzpolizei, S. 199ff.; Leßmann, Mit Manneszucht, S. 83ff.; Knatz, Polizei in der Weimarer Republik, S. 50 f.; Bessel, Policing, S. 199. 1119 Vgl. Leßmann, Mit Manneszucht, S. 87. IV. Die deutsche Polizei in der Zwischenkriegszeit 312 „Die Ansicht, daß es mit der Würde eines Polizeibeamten unvereinbar wäre, ‚Griffe‘ zu üben und ‚exerziermäßig‘ die Waffe zu handhaben oder Bewegungen auszuführen, hat der Einsicht Platz gemacht, daß dies alles nur Mittel zum Zweck ist. Jeder ältere Polizeibeamte weiß, daß in unzähligen Fällen der moralische Eindruck, den das erste Auftreten der Polizei macht, den Ausschlag gibt. Bei einem geschlossenen Einsatz einer auch zahlenmäßig nur kleinen Abteilung kann durch einen exakten Griff, der seinen Eindruck auf die Menge niemals verfehlt, oft genug die Notwendigkeit eines Waffengebrauchs vermieden und dadurch manches Menschenleben geschont werden, weil die aus der Haltung der Beamten sprechende Entschlossenheit die Menge veranlaßt, ihren Widerstand aufzugeben.“1120 Der Autor ließ hier keinen Zweifel an seiner Überzeugung, dass die Polizei in der damaligen Zeit auf den Einsatz von militärtaktischen Mitteln und insbesondere auf militärisches Auftreten angewiesen war, um ihre Aufgaben zufriedenstellend zu erfüllen. Zugleich verdeutlichte sein Beispiel, dass er den geschlossenen Einsatz – beispielsweise bei der Niederschlagung von Aufständen oder der Auflösung von Demonstrationen – als wichtige Referenz bei der Ausgestaltung der Ausbildung der Polizei ansah. Der Bürger bzw. die Bevölkerung kam bei solchen Einsatzkonzeptionen nur als polizeiliches ‚Gegenüber‘ vor, mit dem man nicht vertrauensvoll zusammenarbeitete, sondern das es einzuschüchtern und gegebenenfalls auch mit Waffengewalt zu bekämpfen galt. Der erste Satz deutete aber auch an, dass es offensichtlich in der Polizei auch Personen gab, die eine solche, militärisch geprägte Ausbildung kritisch sahen. Ob diese Ansicht – wie der Autor behauptet – tatsächlich zwischenzeitlich überwunden worden war, darf durchaus angezweifelt werden. Knapp ein Jahr später vertrat Ernst van den Bergh – Ministerialrat und späterer Leiter des Preußischen Polizei-Instituts – in einem Artikel in der ZDPol seine Vorstellungen zu diesem Thema und ließ zugleich eine gewisse Ambivalenz auf Seiten der für die Polizei zuständigen Entscheidungsträger erkennen.1121 So verglich er in seinem Beitrag die Ausbildung der Schutzpolizei explizit mit derjenigen des Heeres und kam dabei dem Ergebnis: 1120 Bartels, Die Polizeischule (5.3.1924), S. 397 f. 1121 Vgl. E. van den Bergh, Die Ausbildung der Schutzpolizei, in: ZDPol, 21. Jg. (1924/25), Nr. 19 (5.1.1925), S. 479 f. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 313 „Die Ausbildung in der Schutzpolizei macht eine völlig andere Einstellung gegenüber den Ausbildungsfragen notwendig. Im Gegensatz zum Heere ist die Schutzpolizei in Aufbau und Aufgaben völlig dezentralisiert und an ihrer polizeilichen Tätigkeit, die sie Tag für Tag ausübt, örtlich gebunden. Das verlangt also in erster Linie vielseitig durchgebildete Einzelpersönlichkeiten. […] So muß auch die Ausbildung selbst ganz anders und erheblich vielseitiger sein.“1122 Diese Formulierung legte zwar große Unterschiede zwischen der Ausbildung von Polizeibeamten und Soldaten nahe, allerdings relativierte sich dies etwas, wenn man die weiteren Ausführungen zu diesem Thema betrachtete. So bezeichnete er die „Körperschulung nicht als ein Hilfsmittel, sondern als wichtigste Grundlage“ der polizeilichen Ausbildung, und betonte zudem die Bedeutung von „Unterordnung“ sowie von „Straffheit in der Abteilung, die im polizeilichen Auftreten die wichtigste Überlegenheit, nämlich die moralische gegenüber Volksmassen gibt“1123. Diese Aussagen standen durchaus in Einklang mit den oben zitierten Einschätzungen von Ludwig Bartels und entsprachen den typischen militärischen Handlungsmustern bei der Bekämpfung von größeren Unruhen und Aufständen. Einen wesentlichen Unterschied zum Heer sah Ernst van den Bergh jedoch im Bereich der Waffenausbildung, die in der Polizei „gegen- über der früheren Ausbildung im Heere ganz erheblich zurücktreten und ganz neue Formen annehmen“1124 sollte. Schließlich wies der Autor noch auf die Notwendigkeit hin, sowohl allgemeinbildende als auch polizeifachliche Inhalte zu vermitteln, ohne jedoch auf ihre Gewichtung im Vergleich zur Körperschulung und Waffenausbildung einzugehen, sondern lediglich vage anzumerken, dass diese vier Aspekte „immer eng zusammenwirken“1125 sollten. Wie diese Spielräume in der Praxis interpretiert werden konnten, verdeutlicht beispielsweise der von Peter Leßmann-Faust in seiner Dissertation angeführte Wochendienstplan einer Düsseldorfer Schutzpolizeibereitschaft, in dem von den insgesamt 26 für Ausbildungszwecke vorgesehenen Stunden lediglich 2 auf polizeifachlichen Unterricht und die restlichen 24 auf Körperschulung und Waffenausbildung entfielen.1126 Inwiefern dieses Beispiel repräsentativ für die polizeiliche Ausbildung oder ein ‚Ausreißer‘ 1122 van den Bergh, Die Ausbildung der Schutzpolizei (5.1.1925), S. 479. 1123 van den Bergh, Die Ausbildung der Schutzpolizei (5.1.1925), S. 479. 1124 van den Bergh, Die Ausbildung der Schutzpolizei (5.1.1925), S. 480. 1125 van den Bergh, Die Ausbildung der Schutzpolizei (5.1.1925), S. 480. 1126 Vgl. Leßmann-Faust, Die Preußische Schutzpolizei, S. 214. IV. Die deutsche Polizei in der Zwischenkriegszeit 314 war, lässt sich kaum zuverlässig einschätzen. Allerdings deutet der von Polizeihauptmann Ernst Jaeger in seinem im Dezember 1926 in der ZDPol erschienenen Beitrag vorgeschlagene Stundenplan für die einjährige Ausbildung von neu eingestellten Polizeianwärtern darauf hin, dass es auch Befürworter einer ausgewogeneren Verteilung der Ausbildungsinhalte gab.1127 Abbildung 14 veranschaulicht diesen von ihm ausdrücklich als „Vorschlag“ bezeichneten Stundenplan. Zu erkennen ist, dass der Stundenplan vor allem zu Beginn der Ausbildung hauptsächlich Körperbildung und Waffenausbildung bzw. -kunde vorsah: im ersten Monat ca. 80% und in den darauf folgenden 3 Monaten ca. 65% der Gesamtstunden. Allerdings wurde diese Stundenzahl ab dem fünften Monat sehr deutlich reduziert, so dass sie dann nur noch ca. 37% der Gesamtstunden ausmachte. Der allgemeinbildende Unterricht an der Polizeiberufsschule umfasste durchgängig 9 Stunden pro Woche, d. h. ca. 20% der Gesamtstunden. Die restlichen Zeiten entfielen auf die Lehrgebiete Polizeikunde, Polizeidienstkunde, Staatskunde und Rechtskunde, die der Autor als ‚gesetzeskundlichen Unterricht‘ zusammenfasste, was auf eine stark juristische Prägung dieser Inhalte schließen lässt. Auch wenn hier eine deutlich ausgewogenere Verteilung der Ausbildungsinhalte als im oben erwähnten Wochendienstplan einer Düsseldorfer Schutzpolizeibereitschaft erkennbar war, so dominierten aber auch in diesem Stundenplan die militärisch orientierten Fächer, so dass man von einer militärisch geprägten Ausbildung der neu eingestellten Polizeianwärter ausgehen muss. Das oben angesprochene Spannungsverhältnis zwischen militärischen Werten wie Disziplin und Gehorsam einerseits und demokratisch-bürgerlichen Werten wie Selbstverantwortung und Kritikfähigkeit andererseits spiegelte sich auch in zahlreichen anderen Beiträgen wider, die sich mit den Anforderungen an und der Ausbildung von Polizeibeamten beschäftigten. Typisch hierfür waren zwei Beiträge, die im Sommer 1925 in der ZDPol erschienen und sich diesbezüglich höchst unterschiedlich positionierten. So betonte der Leiter der Polizeiabteilung im preußischen Innenministerium, Wilhelm Abegg, in seinem im Juli 1925 erschienenen Artikel die unterschiedlichen Ziele von Militär und Polizei, da das Heer auf die „Vernichtung des Gegners“ abziele, wohingegen das Ziel der Polizei – selbst beim Einsatz von geschlossenen Einheiten – darin bestehe, „den Gegner zu schonen, ruhig und besonnen auf einen Ausgleich hinzuarbei- 1127 Vgl. E. Jaeger, Zur Organisation der Ausbildungsveranstaltungen an den Provinz-Polizeischulen (Vorschlag), in: ZDPol, 23. Jg. (1926), Nr. 23 (5.12.1926), S. 671ff. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 315 ten und von scharfen Mitteln nur dann Gebrauch zu machen, wenn alle anderen versagt haben oder nach der Lage der Sache nicht zum Ziel führen“1128. Daraus leitete er die folgenden Zielvorgaben für die Ausbildung beim Militär und bei der Schutzpolizei ab. „Das Heer hat zu unbedingtem Gehorsam zu erziehen, der Soldat handelt nach gegebenem Befehl, sein eigener Wille und seine Verantwortlichkeit sind – im ganzen gesehen – ausgeschaltet. Das Handeln des Reichswehrangehörigen ist typisiert. Der Schutzpol.-Beamte, der gerade für die Verwendung im Einzeldienst vorgebildet werden muß, handelt bei aller Disziplin, die auch für ihn eine Selbstverständlichkeit bedeutet, – im großen gesehen – fast immer unter eigener Verantwort- 1128 W. Abegg, Ausbildung und Verwendung der Schutzpolizei, in: ZDPol, 22. Jg. (1925), Nr. 8 (20.7.1925), S. 223. Stundenplan für die einjährige Ausbildung von Polizeianwärtern 1926Abb. 14: IV. Die deutsche Polizei in der Zwischenkriegszeit 316 lichkeit und nichts ist für seine Ausbildung gefährlicher als die Typisierung der Verwendungsmöglichkeiten.“1129 Es war vor allem die markante Gegenüberstellung des unselbständig agierenden Soldaten und des eigenverantwortlich handelnden Polizisten, die Wilhelm Abegg zufolge den grundlegend unterschiedlichen Ausbildungsansatz dieser beiden Institutionen verdeutlichten. Polizeibeamte im Streifen- bzw. Einzeldienst, die in ihrem Arbeitsalltag stets in engem Kontakt mit verschiedenen Menschen standen, mit sehr unterschiedlichen, nicht planbaren Situationen und Problemen umgehen mussten und dabei in der Regel keine Möglichkeit hatten, eine Anweisung eines Vorgesetzten einzuholen, benötigten offensichtlich andere Kompetenzen als Soldaten. Das Ausbildungsziel bei der Schutzpolizei formulierte er daher folgenderma- ßen: „Die Ausbildung der Schutzpolizeibeamten steht im Dienste ihrer Erziehung, die, wie jede Erziehung, zur Selbsterziehung befähigen soll. Das Ziel der Erziehung ist die Heranbildung von selbstsicheren, zuverlässigen und verantwortungsfreudigen Persönlichkeiten, die bereit und befähigt sind, im Dienste der Erhaltung der Staatsautorität zu wirken und sich ihrer Stellung als Träger staatlicher Hoheitsrecht jederzeit bewußt sind.“1130 Gerade Wilhelm Abeggs Heranziehung der Werte Selbstsicherheit und Verantwortungsfreudigkeit verdeutlichte erneut die unterschiedlichen Paradigmen, die der Polizeiausbildung einerseits und derjenigen des Heeres andererseits zu Grunde lagen und zu entsprechend unterschiedlich ausgestalteten Ausbildungswegen führen müssten. Betrachtete man allerdings den Rest des Beitrags, dann fand man keine konkreten Hinweise darauf, wie das polizeiliche Ausbildungssystem Mitte der der 1920er Jahre die von Wilhelm Abegg erwähnten Ziele erreichen sollte. Stattdessen wiederholt der Autor lediglich die vier Ausbildungsbestandteile, die auch schon Ernst van den Bergh in seinem weiter oben behandelten Beitrag angeführt hatte, nämlich allgemeinbildender und polizeifachlicher Unterricht sowie Körperschulung und Waffenausbildung.1131 Diese vier Komponenten wurden von Wilhelm Abegg zwar relativ ausführlich erläutert, allerdings verzichtete auch er auf eine Gewichtung, so dass eine Übergewichtung der eher mi- 1129 Abegg, Ausbildung und Verwendung der Schutzpolizei (20.7.1925), S. 223. 1130 Abegg, Ausbildung und Verwendung der Schutzpolizei (20.7.1925), S. 224. 1131 Vgl. van den Bergh, Die Ausbildung der Schutzpolizei (5.1.1925), S. 479 f.; Abegg, Ausbildung und Verwendung der Schutzpolizei (20.7.1925), S. 224 f. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 317 litärisch geprägten Körperschulung und Waffenausbildung nicht ausgeschlossen werden konnte. Dass dieses Versäumnis möglicherweise kein Versehen war, sondern bewusst geschah, legten die weiteren Ausführungen des Autors in der zweiten Hälfte dieses Beitrags nahe, die sich mit der „erst in der Nachkriegszeit neu hinzugetretenen Aufgabe der Polizei, die Verwendung geschlossenen polizeilichen Einsatzes zur Bekämpfung und Unterdrückung innerer Unruhen“1132, beschäftigten. Auch wenn er immer wieder darauf hinwies, dass die Polizei bei solchen Einsätzen ganz andere Ziele als das Militär und keinesfalls die Vernichtung des Gegners bzw. der Aufständischen verfolgen sollte, war doch die von ihm dann verwendete Sprache so eindeutig militärisch geprägt, dass sich daraus durchaus entsprechende Rückschlüsse auf das polizeiliche Ausbildungswesen ziehen lassen konnten, wie die folgende Passage verdeutlichte: „Bei dieser Lage werden sich bei einem angriffsweisen Vorgehen gegen geschlossene Stadtzentren fast immer für die Führung innerhalb der ganzen Aktion folgende, zeitlich nacheinander umgrenzte Abschnitte ergeben: a)Schaffung einer gesicherten Ausgangstellung für die Bereitstellung der Polizeikräfte. b) Vorgehen besonderer Trupps zur Aufklärung und Beseitigung antreffenden Widerstandes auf den näher bezeichneten Straßen. c)Bei auftretendem Widerstand und nach Beseitigung dieses durch die vorausgesandten Trupps Nachziehen von Säuberungstrupps zur genauen Absuchung des genommenen Geländes. d)Alsdann erst Nachziehen der geschlossenen Pol.-kräfte auf den ihnen zugewiesenen Straßen.“1133 Sowohl die Bezeichnung der Polizeieinheiten als „Trupps“ und sogar als „Säuberungstrupps“ sowie die Aufforderung, gegen das Stadtzentrum ‚angriffsweise vorzugehen‘ und den Widerstand zu ‚beseitigen‘, sprechen eine deutliche, von militärischen Denk- und Handlungsmustern geprägte Sprache, die den Lesern dieses Beitrags verdeutlichen musste, dass der Leiter der Polizei im preußischen Innenministerium von der ihm unterstellten Schutzpolizei bei der Bekämpfung von Unruhen und Aufständen militärtaktisches Vorgehen und massiven Schusswaffeneinsatz erwartete, so dass entsprechende Inhalte im Rahmen der Ausbildung zu vermitteln waren. Die sich darin widerspiegelnde Ambivalenz dürfte es insbesondere den An- 1132 Abegg, Ausbildung und Verwendung der Schutzpolizei (20.7.1925), S. 226. 1133 Abegg, Ausbildung und Verwendung der Schutzpolizei (20.7.1925), S. 227. IV. Die deutsche Polizei in der Zwischenkriegszeit 318 gehörigen des rechtskonservativ orientierten, militärerfahrenen Polizeioffizierskorps leicht gemacht haben, bei der Ausbildung von Schutzpolizisten weiterhin militärischen Werten und Normen wie Disziplin und Gehorsam eine herausragende Bedeutung zu Lasten von eher demokratisch-bürgerlichen Werten wie Selbständigkeit und Eigenverantwortlichkeit beizumessen. Für diese These sprach auch der einen Monat zuvor, im Juni 1925 in der ZDPol erschienene Beitrag des an der Polizeischule Münster tätigen Polizeihauptmanns Otto Peter mit dem bezeichnenden Titel „Manneszucht – Ein Weckruf an den Polizei-Anwärter“.1134 Unabhängig davon, ob man den Begriff der ‚Manneszucht‘ wie Peter Leßmann-Faust als „Topos, der die seit dem Kaiserreich extrem idealisierten Inhalte und Ziele stupiden militärischen Drills und eines den einzelnen Soldaten auf gleichsam maschinelle Eigenschaften reduzierenden Menschenbildes bündelte“1135, oder einfach nur als veraltete Bezeichnung für ‚Disziplin‘ betrachtet, so handelt es sich auf jeden Fall allein schon begrifflich, aber auch inhaltlich um ein mit der Organisationskultur der Polizei und insbesondere mit den darin fest verwurzelten Werten wie Männlichkeit, Stärke, Zwang, Gehorsam, Konformität und Solidarität hochkompatibles Konzept.1136 Der Beitrag von Otto Peter enthielt zahlreiche Passagen, die von den Lesern als eindeutiges Plädoyer für ein dezidiert am Vorbild des Militärs orientiertes polizeiliches Ausbildungswesen interpretiert werden mussten, wie die folgenden Ausführungen verdeutlichen: „[…] so darf mit Recht wohl gesagt werden, daß der Staat an die Spitze der Tugenden, die er von einem Schutzpolizeibeamten erwartet, die Manneszucht stellt. […] Manneszucht ist der Inbegriff aller Tüchtigkeit, die der Schutzpolizeibeamte in sich tragen soll […]. Sie allein ist es, die die Beamtenschaft zu einem festgefügten, stahlharten Körper zusammenschweißt, der parteilos und unbeirrt zum Wohle von Staat und Volk seiner schweren Pflicht genügt, befähigt, allen von außen kommenden, verderblichen Einflüssen erfolgreich zu begegnen und dem Gesetz Geltung zu verschaffen. In einer auf Zucht und Ordnung 1134 Vgl. O. Peter, Manneszucht – Ein Weckruf an den Polizei-Anwärter, in: ZD- Pol, 22. Jg. (1925), Nr. 6 (20.6.1926), S. 200 f. 1135 Leßmann, Mit Manneszucht, S. 79. 1136 Vgl. Chan, Fair Cop, S. 201ff.; Cullen, Link, Travis, Lemming, Paradox in Policing, S. 351ff.; Dick, Dirty Work Designations, S. 1363ff; Waddington, Police (Canteen) Subculture, S. 287ff.; Manning, Police Work, S. 148ff. und S. 259ff. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 319 fest begründeten Polizeibeamtenschaft vertraut der Unterbeamte auf seinen Vorgesetzten, vertraut der Vorgesetzte in gleicher Weise auf die ihm von Staat zu getreuen Händen und unter voller persönlicher Verantwortung übergebenen Beamten.“1137 Wie man es von einem konservativen Polizeioffizier wohl erwarten durfte, vertrat Otto Peter hier nicht etwa die Ansicht, dass Disziplin eine wichtige Eigenschaft von Polizeibeamten sein sollte, sondern die vielmehr die wichtigste. Das extrem konservative Menschenbild und militärisch geprägte Polizeiverständnis des Autors verdeutlichten insbesondere die Charakterisierung der Polizei als auf „Zucht und Ordnung“ basierenden, „stahlharten Körper“ sowie die Vorstellung, dass der Staat die jungen Polizeibeamten bzw. -anwärter ihren Vorgesetzten bzw. den Polizeioffizieren „zu getreuen Händen“ übergab. Zudem erinnerte er sehr deutlich „an die hohen Pflichten der Unterordnung und des Gehorsams“ und stellte fest, dass für Polizeibeamte, die Befehle ihrer Vorgesetzten nicht befolgten oder auch nur in Frage stellten, „nimmermehr Platz in der Schutzpolizei“1138 sei. Da Otto Peter offensichtlich als Ausbilder oder Dozent an der Polizeischule Münster beschäftigt war, verwundert es nicht, dass er diese Haltung auch auf die polizeiliche Ausbildung übertrug und dementsprechend forderte: „In diesem Sinne rufe ich den jungen Anwärter an der Polizeischule zur eifrigsten Pflichterfüllung auf, auf daß er sich in redlichem Wollen befleißige, schon in seiner Ausbildungszeit die sittliche Forderung der Manneszucht in ihrer ganzen Größe zu erfassen und ihre Werte zu seinem und des Dienstes Besten in sich groß werden zu lassen.“1139 Diesem Plädoyer für Disziplin ließ er einige konkrete Hinweise folgen, was dies im Ausbildungsalltag bedeuten könnte, und verwies dabei auf traditionelle Werte wie „Pünktlichkeit“, „Reinlichkeit“ und „Ordnung“. Insgesamt vermittelte der Beitrag den Eindruck, dass der Autor ein extrem konservatives, an militärischen Werten orientiertes Verständnis von Polizeiarbeit hatte, das angesichts seiner Tätigkeit als Dozent oder Ausbilder an einer Polizeischule Rückschlüsse auf eine entsprechende Ausrichtung der polizeilichen Ausbildung erlaubt, die nur schwer mit Wilhelm Abeggs be- 1137 Peter, Manneszucht – Ein Weckruf an den Polizei-Anwärter (20.6.1926), S. 200. 1138 Peter, Manneszucht – Ein Weckruf an den Polizei-Anwärter (20.6.1926), S. 200. 1139 Peter, Manneszucht – Ein Weckruf an den Polizei-Anwärter (20.6.1926), S. 201. IV. Die deutsche Polizei in der Zwischenkriegszeit 320 reits weiter oben behandelten Vorstellungen in Einklang zu bringen war, dass das Ziel der Polizeiausbildung „die Heranbildung von selbstsicheren, zuverlässigen und verantwortungsfreudigen Persönlichkeiten“1140 sei. Die gestiegene Bedeutung des polizeilichen Ausbildungswesens spiegelte sich auch darin wieder, dass im Dezember 1926 die ZDPol ein Sonderheft zu diesem Themenfeld herausgab. Die dort publizierten Beiträge, die sich u. a. mit dem polizeilichen Ausbildungssystem, den Lehr- und Stundenplänen, der Rolle des Leiters einer Polizeischule und den für die Aus- übung des Polizeiberufs benötigten Fachkenntnissen und Kompetenzen beschäftigten, zielten offensichtlich darauf ab, der Leserschaft dieser Zeitschrift die Vorzüge eines modernen, an demokratischen Leitbildern orientierten polizeilichen Ausbildungswesen zu verdeutlichen. Gleichwohl konnte man auch in diesen Beiträgen die bereits weiter oben schon thematisierte, ambivalente Haltung zur Bedeutung von militärischen Denk- und Handlungsmustern feststellen. Der einleitende Beitrag mit dem Titel „Das Polizeibildungswesen“ von Hermann Degenhardt, Oberregierungsrat im SPD-geführten preußischen Innenministerium, gab einen Überblick über das Ausbildungssystem der preußischen Polizei Mitte der 1920er Jahre und plädierte dabei für dessen konsequente Demokratisierung.1141 Dabei betonte er vor allem die wichtige Rolle der für die allgemeinbildenden Inhalte zuständigen Polizeiberufsschule, wie die folgende Passage verdeutlichte: „Der Polizeibeamte, der Schützer von Recht und Ordnung, steht in einem besonderen Treueverhältnis zum Staate, zur deutschen demokratischen Republik, deren Bestand gegebenenfalls mit Leib und Leben zu schützen er sich verpflichtet hat, sie im Sinne und Geiste der Verfassung weiterzuentwickeln ihm persönliche Aufgaben sein soll. Das Wesen dieses, unseres Staates soll er aus seinem Werden und seiner sozialen Struktur erfassen lernen, erfassen mit dem Geist und mit dem Herzen. Unter dem Gesichtspunkte ist der Stoff für den Unterricht in der Polizeiberufsschule ausgewählt und zu behandeln. […] Die Polizeiberufsschule ist, soweit wir sehen, die erste Schule dieser Art und ist noch die einzige, die diesen erzieherischen Zweck bewußt in den Vordergrund der allgemeinen Ausbildung von Beamten gerückt hat, ihn als eine Voraussetzung für jede Berufsausbildung dieser Art ansieht. Die Folgezeit wird lehren, ob andere Verwaltungen ihr folgen. Damit ist die Polizeiberufsschule vor eine gewaltige pädagogische Herausfor- 1140 Abegg, Ausbildung und Verwendung der Schutzpolizei (20.7.1925), S. 224. 1141 Vgl. Degenhardt, Das Polizeibildungswesen (5.12.1926), S. 669ff. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 321 derung gestellt worden: die Methodik des staatsbürgerlichen Unterrichts (i. w. S.) auszubilden. Das ist das Kernproblem, um das z. Zt. gerungen wird.“1142 Hermann Degenhardt machte hier zunächst seinen Lesern unmissverständlich klar, dass der Polizeibeamte keinesfalls eine neutrale Haltung zum Staat bzw. zur Staatsform haben sollte, sondern dass es vielmehr seine Aufgabe war, die demokratische Grundordnung der Weimarer Republik uneingeschränkt zu akzeptieren, zu verinnerlichen und sogar „im Sinne und Geiste der Verfassung weiterzuentwickeln“. Den Polizeiberufsschulen kam dabei eine fundamentale Rolle zu, da es ihre Aufgabe war, die Polizeibeamten, vor allem aber die neu eingestellten Polizeianwärter zu einer solchen Gesinnung zu erziehen. Wie dies in der Ausbildungspraxis erfolgen sollte, konkretisierte er dahingehend, dass er für die Entwicklung eines speziellen Lehrfachs eintrat, nämlich die Staatsbürgerkunde, die auf die Erreichung dieses Lernziels ausgerichtet sein sollte. Dass dies angesichts der traditionellen Dominanz von rechtskonservativen, republikkritischen Haltungen in der deutschen und preußischen Beamtenschaft und speziell im Polizeioffizierskorps eine große Herausforderung mit einem enormen Konfliktpotenzial darstellte, war dem Autor offenbar durchaus bewusst, wie sein Hinweis auf „das Kernproblem, um das z. Zt. gerungen wird“, verdeutlichte. Gleichwohl deutete sein dezidiertes Eintreten für die Verankerung von demokratischen Werten in die Polizeiausbildung darauf hin, dass er davon ausging oder zumindest hoffte, dass die Polizeiberufsschule Modellcharakter auch für andere Bereiche des öffentlichen Sektors haben würde. Aber auch über die Polizeiberufsschule hinaus sah er das gesamte polizeiliche Ausbildungssystem in der Pflicht, zur Modernisierung und Demokratisierung der Polizei beizutragen, wie der Abschluss seines Beitrags verdeutlichte: „Das Polizeibildungswesen steht – wie jedes Bildungswesen – im Dienste einer Idee: des Polizeigedankens der neuesten Zeit. Polizei im Volksstaat ist nicht so sehr Ausdruck des Machtgedankens des Staates als Funktion des sozialen Willens. In dieser Einstellung zum Bildungsproblem der Polizei liegt die Gewähr für den Erfolg aller Erziehungsund Bildungsarbeit im Hinblick auf die Notwendigkeiten unserer Zeit.“1143 1142 Degenhardt, Das Polizeibildungswesen (5.12.1926), S. 670. 1143 Degenhardt, Das Polizeibildungswesen (5.12.1926), S. 671. IV. Die deutsche Polizei in der Zwischenkriegszeit 322 Das sich darin widerspiegelnde unmissverständliche Bekenntnis zur demokratischen Grundordnung und zur Verankerung demokratischer Werte in das polizeiliche Ausbildungswesen zeigte sich auch in den meisten anderen, größtenteils von Polizeibeamten verfassten Beiträgen, die im betreffenden Sonderheft der ZDPol zu diesem Themenfeld erschienen, so dass davon auszugehen ist, dass diese Haltung durchaus eine nicht unerhebliche Zahl an Anhängern in der deutschen Polizei in den mittleren Jahren der Weimarer Republik gehabt haben dürfte. Allerdings ließ sich daraus keinesfalls ableiten, dass dies die dominierende Haltung war. Dies verdeutlichte nicht zuletzt ein ebenfalls in diesem Heft erschienener Aufsatz eines nicht näher spezifizierten Autors namens Schmidt-Hern, der sich mit den Aufgaben des Leiters einer Polizeischule bei der Ausbildung und Erziehung des Polizeinachwuchses befasste.1144 Es wurden zwar keine Angaben zur Person des Autors gemacht, allerdings ist angesichts des Themas und der Art und Weise, wie er darüber berichtete, davon auszugehen, dass er entweder amtierender oder ehemaliger Leiter einer Polizeischule und damit Angehöriger des Polizeioffizierskorps war. Dabei stellte Schmidt-Hern direkt zu Beginn erwartungsgemäß fest, dass die zentrale Aufgabe des Leiters einer Polizeischule die Erziehung und Ausbildung des Polizeinachwuchses sei, bevor er genauer auf diese Rolle einging und hierzu erläuterte: „Leitsatz für alle seine Entscheidungen und Maßnahmen sei ihm die Einleitung zur A. W. D. I [Ausbildungsvorschrift für den waffenpolizeilichen Dienst, Teil 1]: 1. ‚Nur eine Schutzpolizei, welche straff diszipliniert ist, hat Daseinsberechtigung.‘ 2. ‚Diesen hohen Anforderungen kann nur durch restlose Hingabe an den Dienst, straffste Unterordnung unter die Vorgesetzten und festen inneren Zusammenhalt des Beamtenkörpers entsprochen werden.‘ 1144 Vgl. Schmidt-Hern, (Vorname fehlt), Die Tätigkeit des Leiters einer Provinz.- Polizeischule in Bezug auf die Erziehung und Heranbildung des jungen Nachwuchses der Schutzpolizei, in: ZDPol, 23. Jg. (1926), Nr. 23 (5.12.1926), S. 677ff. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 323 Hat er diese Leitsätze bei allen Ausbildungs- und Erziehungsmaßnahmen stets im Auge, wobei auf die Erziehung der Hauptton zu legen ist, dann wird ihm der Erfolg nicht versagt bleiben.“1145 Diese Passage, die der Autor am Anfang des Beitrag platzierte und damit ihre Bedeutung unterstrich, erklärte die militärischen Werte ‚Disziplin‘ und ‚Gehorsam‘ zu den zentralen Leitprinzipien der Ausbildung von Polizeibeamten und musste daher als ein klares Indiz dafür gesehen werden, dass die von der preußischen Landesregierung betriebene Demokratisierung der Verwaltung im Jahr 1926 noch nicht in alle Bereiche der Polizei gedrungen war. Interessanterweise zitierte Schmidt-Hern hier die Einleitung zu der am 4. Februar 1921 veröffentlichten Ausbildungsvorschrift für den waffenpolizeilichen Dienst, die vom preußischen Innenminister Carl Severing und damit vom wohl prominentesten Vertreter dieser Demokratisierungsstrategie1146 geschrieben wurde. Auch wenn man nicht ausschlie- ßen kann, dass sich die Einstellung von Carl Severing zur Bedeutung von Disziplin und Gehorsam in der Polizei in den Jahren zwischen 1921 und 1926 möglicherweise etwas geändert hatte, so verdeutlichte diese Passage, warum ihm „ein gewisses Faible für das Militärische“1147 zugeschrieben wurde und er – obwohl „durch und durch sozialdemokratisch“1148 – im linken politischen Spektrum und in der Arbeiterschaft als „ausgesprochene Reizfigur“1149 galt. Konservativen Polizeioffizieren wie Schmidt- Hern dienten solche schriftlich in Erlassform publizierten Aussagen des preußischen Innenministers sicherlich als gewichtiges Argument, um die Demokratisierung und Modernisierung der Polizei zumindest in ihrem Zuständigkeitsbereich zu verzögern oder sogar zu blockieren. Sein militärisch geprägtes, traditionelles Polizeiverständnis und das sich daraus ergebende konservative, teilweise auch spießbürgerliche Ausbildungsverständnis zeigten sich auch in seinen weiteren Ausführungen, in denen er u. a. forderte: „Das heißt, aus den jungen Anwärtern sollen brave, tüchtige, unerschrockene deutsche Jungens mit fröhlichen Gesichtern erzogen wer- 1145 Schmidt-Hern, Die Tätigkeit des Leiters einer Provinz.-Polizeischule (5.12.1926), S. 677. 1146 Vgl. H. Lademacher, Biografie von Carl Severing, http://www.westfaelische-ge schichte.de/per1415 (Zugriff: 12.2.2018). 1147 T. Alexander, Carl Severing – Sozialdemokrat aus Westfalen mit preußischen Tugenden, Bielefeld 1992, S. 156. 1148 Lademacher, Biografie von Carl Severing, o. S. 1149 Schmidt, Schützen und Dienen, S. 48. IV. Die deutsche Polizei in der Zwischenkriegszeit 324 den, die unbedingtes Pflichtbewußtsein haben, ein reichliches Maß besitzen an Gerechtigkeitsgefühl, hervorragender anständiger Gesinnung, kameradschaftlichen Geist und Höflichkeit […]. Pünktlichkeit, Ordentlichkeit, Sauberkeit, Nüchternheit, Taktgefühl, gute Formen, Sparsamkeit – Anlage von Sparkassenbüchern – und Genügsamkeit sind weitere wichtige Eigenschaften, die ein Polizeibeamter in ausgeprägter Weise besitzen muß.“1150 Was man jedoch in diesem Beitrag kaum finden konnte, waren politische Bezüge. So erwähnte Schmidt-Hern zwar, dass der Polizeianwärter „über den Staat und seine Einrichtungen und über die Pflichten und Rechte eines Staatsbürgers“1151 belehrt werden müsse, allerdings suchte man vergeblich nach Hinweisen auf das besondere, beamtenrechtlich begründete Treueverhältnis zur Weimarer Republik und die sich daraus ergebende Pflicht der Polizei, die demokratische Grundordnung zu verteidigen, wie sie beispielsweise im oben erörterten Beitrag von Hermann Degenhardt vehement eingefordert wurde. Stattdessen forderte Schmidt-Hern, dass „[j]ede parteipolitische Beeinflussung auf der Schule […] unterbunden werden [müsse]“1152. Auch wenn die politische Neutralität der Akteure im Bildungswesen im Rahmen von Lehrtätigkeiten in einem demokratischen Rechtsstaat sicherlich zweckmäßig und geboten war und immer noch ist, so erzeugte der Autor hier gerade vor dem Hintergrund der konsequenten Vermeidung jeglicher Bezüge zur demokratischen Verfasstheit der Weimarer Republik und seines dezidierten Eintretens für konservativ-autoritäre Werte wie Disziplin und Gehorsam den Eindruck, dass er einem militärisch geprägten Polizeiverständnis anhing, ein distanziertes Verhältnis zu Demokratie und Republik pflegte und einer Verankerung von demokratischen Werten und Leitbildern in der Polizeiausbildung äußerst kritisch gegenüberstand. Dass sich solche Einstellungen auch in den nächsten Jahren in der deutschen Polizei hielten und möglicherweise sogar an Bedeutung gewannen, zeigte ein im September 1928 in der ZDPol veröffentlichter Beitrag des Polizeihauptmanns Martin Gilbert mit dem Titel „Über Drill und Erzie- 1150 Schmidt-Hern, Die Tätigkeit des Leiters einer Provinz.-Polizeischule (5.12.1926), S. 677. 1151 Schmidt-Hern, Die Tätigkeit des Leiters einer Provinz.-Polizeischule (5.12.1926), S. 678. 1152 Schmidt-Hern, Die Tätigkeit des Leiters einer Provinz.-Polizeischule (5.12.1926), S. 678. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 325 hung in der Polizei‘.1153 Wie bereits die im Folgenden wiedergegebene, einleitende Passage andeutete, zielte der Beitrag darauf ab, die Notwendigkeit und Zweckmäßigkeit von ‚Drill‘ in der Polizei und insbesondere in der Polizeiausbildung hervorzuheben. „Zu dem Vielen, was in der geistigen Verwirrung des Zusammenbruchs zunächst in Mißkredit geraten war, gehört der Drill. Drill – meinte man – sei etwas spezifisch Militärisches. Damit wurde dieser Begriff zum Schreckgespenst. Die Jahre, die seither vergangen sind, haben manchen gelehrt, mit ruhigen Augen anzusehen, was er im ersten Augenblick verwerfen zu müssen geglaubt hatte. Und so können wir heute sine ira et studio wieder über Dinge reden, die, einst leidenschaftlich angefochten, letzten Endes doch nicht zu entbehren sind.“1154 Dabei führte der Autor das negative Image von Drill in der Öffentlichkeit und der Polizei auf ein Missverständnis oder eine falsche Wahrnehmung zurück, die in der Gründung der Weimarer Republik ihren Anfang nahm, seitdem aber wieder korrigiert worden war. Auch wenn der Beitrag ansonsten politisch neutral gehalten war und die Begriffe ‚Demokratie‘ und ‚Republik‘ an keiner Stelle erwähnt wurden, so deutete doch der in diesen ersten Satz enthaltene Hinweis auf die „geistige Verwirrung“ nach der Revolution von 1918 auf eine tendenziell eher kritische Haltung des Autors zur demokratischen Grundordnung der Weimarer Republik hin. Vor allem zeigte der Beitrag aber, dass Martin Gilbert sich offensichtlich militärischen Traditionen und Werten verpflichtet fühlte, was sicherlich nicht zuletzt daran lag, dass er vor seinem Eintritt in die Polizei Sachsens in Jahr 1920 bereits mehr als 12 Jahre beim Heer – u. a. während des Ersten Weltkrieges als Offizier sowohl an der West- wie auch an der Ostfront – gedient hatte. Im Jahr 1934 trat er wieder in die Armee ein, und während des Zweiten Weltkriegs stieg er bis zum Generalleutnant auf.1155 In seinem Beitrag definierte er ‚Drill‘ folgendermaßen: „Was ist Drill? Ganz allgemein gesagt, die exakte, gleichmäßige Handhabung ganz bestimmter Fertigkeiten, die ohne jegliche geistige Überlegung ausgeführt werden müssen. Müssen: denn es ist ja gerade der 1153 Vgl. M. Gilbert, Über Drill und Erziehung in der Polizei, in: ZDPol, 25. Jg. (1928), Nr. 17 (5.9.1928), S. 529ff. 1154 Gilbert, Über Drill und Erziehung in der Polizei (5.9.1928), S. 529. 1155 Vgl. http://www.lexikon-der-wehrmacht.de/Personenregister/G/GilbertM.htm (Zugriff: 12.2.2018). IV. Die deutsche Polizei in der Zwischenkriegszeit 326 Sinn dieser Mechanisierung, daß die Überlegung des Mannes durch die Ausführung nicht abgelenkt wird. Insofern ist Drill auch nicht spezifisch militärisch. Es bedarf seiner der Kraftfahrer bei der Bedienung seines Motors, der Fahrer der elektrischen Straßenbahn, überhaupt jeder, der eine immer wiederkehrende körperliche Tätigkeit ausüben und dabei seinen Blick und seine Überlegung anderen Dingen zuwenden muß.“1156 An dieser Definition war allerdings nur der erste Teil korrekt, der ‚drillen‘ als mechanisches Einüben von Fertigkeiten umschrieb, so dass die gedrillte Person in die Lage versetzt wurde, bestimmte Tätigkeit korrekt auszuführen, ohne nachzudenken. Dass der Zweck des Drills aber darin liegen sollte, dass die betreffende Person nicht davon abgelenkt wurde und seine Gedanken ‚frei schweifen‘ lassen konnte, erscheint gerade in Bezug auf den militärischen Ernstfall, bei dem es auf ‚blinden‘ Gehorsam ankommt, wenig plausibel. Und auch die Beispiele des Straßenbahnfahrers oder Kraftfahrers erscheinen ziemlich unpassend und dürften auch im Jahr 1928 kaum den Vorstellungen in Bezug auf ‚Drill‘ entsprochen haben, die in der Bevölkerung verbreitet waren. Insgesamt erscheint diese Definition unredlich, tendenziös und darauf ausgerichtet, dem Leser dieses Beitrags ein positives Bild von Drill zu vermitteln. Dieses Bild verstärkte Martin Gilbert im weiteren Verlauf seines Beitrags, indem er die angeblich positiven Aspekte des Drills betonte, ohne sie allerdings zu belegen, während er die negativen Aspekte kaum erwähnte. „Dem Drill an sich haftet absolut nichts Verächtliches an. Er ist die Grundlage weiterer Erziehung des Beamten zur Persönlichkeit. Denn nur wer sich in Gewalt hat, kann Gewalt über andere ausüben. […] Die Unterwerfung unter den Drill ist dem jungen Anwärter ganz selbstverständlich. Er hat sich den Polizeiberuf freiwillig gewählt und findet sich mit der harten Anfangsschule sehr viel leichter ab als der Rekrut des alten Heeres, der dem Zwange der Aushebung Folge leisten mußte. […] Die Grundeinstellung des jungen Mannes zu seinem Lebensberufe macht aus dem Zwange der Aneignung der nötigen Fertigkeiten in der körperlichen und waffentechnischen Ausbildung für ihn eine Freude an der eigenen Leitung, die durch gegenseitigen Wetteifer bei gleicher Veranlagung noch gesteigert wird.“1157 1156 Gilbert, Über Drill und Erziehung in der Polizei (5.9.1928), S. 529. 1157 Gilbert, Über Drill und Erziehung in der Polizei (5.9.1928), S. 530. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 327 Die zitierten Passagen enthielten zwar positiv Wertungen, allerdings handelte es dabei durchgängig um unbelegte, teilweise nichtssagende Behauptungen. So fehlte insbesondere eine Erläuterung, auf welche Art und Weise Drill zur Persönlichkeitsbildung beitragen und warum sich daraus ein Kausalzusammenhang zwischen Selbstkontrolle und Gewalt- bzw. Machtausübung über andere Menschen ableiten lassen sollte. Fragwürdig waren aber auch die Einschätzungen des Autors, dass Drill für junge Polizeianwärter eigentlich ‚selbstverständlich‘ und sogar ‚eine Freude‘ sei, nicht zuletzt weil man sich dann fragen musste, warum eine so normale und erfreuliche Tätigkeit wie Drill nach der Gründung der Weimarer Republik – wie er in diesem Beitrag selber anmerkte – derart „in Mißkredit geraten“ und „zum Schreckgespenst“1158 werden konnte. Interessant waren auch die beiden folgenden Aussagen des Autors: „Damit will ich nicht geistlosem Exerzieren das Wort reden, womit nur Stunden gefüllt werden. Das ist unbedingt zu verwerfen und schadet mehr als es nützt. […] Ohne Zweifel kann die auf exerziermäßigen Drill aufgebaute und durch wiederkehrende Übungen frisch erhaltene Grundausbildung gar nicht hart und sorgfältig genug sein.“1159 Damit deutete der Autor an, dass man zwischen ‚geistlosem‘ und ‚geistreichem‘ Exerzieren unterscheiden könnte, ohne allerdings zu erläutern, worin der Unterschied liegen könnte. Auszuschließen ist, dass er hier ‚Exerzieren‘ als Gegensatz zu ‚Drill‘ meinte, da er die Begriffe in seinem Beitrag in der Regel miteinander verband – z. B. als ‚exerziermäßigen Drill‘ in der zweiten eben zitierten Aussage – oder synonym verwendete. Vielmehr ist davon auszugehen, dass Drill bzw. Exerzieren gemäß der bereits oben zitierten, eigenen Definition von Martin Gilbert stets „ohne jegliche geistige Überlegung ausgeführt werden [muss]“1160, so dass der Leser dieses Beitrag bei einer genauerem Auseinandersetzung mit dem Text zu dem Ergebnis hätte kommen müssen, dass sich der Autor hier selbst widersprach und sinnlose Aussagen machte. Ob dies von der Leserschaft oder zumindest einem substanziellen Teil davon tatsächlich erkannt wurde, ist nicht mehr nachzuvollziehen. Allerdings haben ihm offensichtlich weder seine widersprüchlichen, unsinnigen Feststellungen noch das von ihm in diesem Beitrag vermittelte, von militärischen Denk- und Handlungsmustern geprägte Polizeiverständnis oder sein engagiertes Plädoyer für eine auf militäri- 1158 Gilbert, Über Drill und Erziehung in der Polizei (5.9.1928), S. 529. 1159 Gilbert, Über Drill und Erziehung in der Polizei (5.9.1928), S. 530. 1160 Gilbert, Über Drill und Erziehung in der Polizei (5.9.1928), S. 529. IV. Die deutsche Polizei in der Zwischenkriegszeit 328 schem Drill aufbauende Polizeiausbildung bei seinem weiteren Karriereweg in der sächsischen Polizei, der ihn zwei Jahre später zum Polizeimajor und weitere vier Jahre später sogar zum Polizeioberstleutnant führen sollte1161, geschadet. Zusammenfassend ist folglich festzuhalten, dass in den mittleren Jahren der Weimarer Republik zwar zweifelsohne erhebliche Anstrengungen unternommen wurden, um die Ausbildung der deutschen Polizei auszubauen, zu vereinheitlichen, zu professionalisieren und insbesondere in Preu- ßen auch im Sinne einer Verankerung von demokratischen Werten und Leitbildern in der Polizeiausbildung zu demokratisieren. Während der Auf- und Ausbau eines reichsweiten Netzes an Polizeischulen und Polizeiberufsschulen sicherlich zu einer deutlichen Verbesserung der fachlichen Qualität des polizeilichen Ausbildungswesens geführt haben dürfte, muss der Erfolg der Demokratisierungsbemühungen angesichts der doch zahlreichen Hinweise auf eine Persistenz von konservativen, anti-republikanischen, militärisch geprägten Haltungen im für die Ausbildung zuständigen Polizeioffizierskorps allerdings deutlich skeptischer eingeschätzt werden. Eine wichtiger Erklärungsansatz hierfür dürfte in der oben im theoretischen Teil dieser Arbeit erörterten Organisationskultur der Polizei gelegen haben, die die Polizei zu einer von militärischen Denk- und Handlungsmustern geprägten Organisation macht, die hierarchisch-autoritative Entscheidungsstrukturen pflegt und von ihren Angehörigen Gehorsam und Konformität erwartet.1162 Da Organisationskulturen im Unterbewusstsein der Organisationsmitglieder verankert sind und über alle Hierarchieebenen hinweg ihr Denken und Handeln maßgeblich beeinflussen, dürfte dies eine Ursache für die Ambiguität und teilweise widersprüchliche Haltung sein, die weiter oben bei der Analyse der in der ZDPol publizierten Beiträge in Bezug auf die Rolle von militärischen Traditionen und Werten in der Polizei sogar auf der Ebene des preußischen Innenministeriums festgestellt worden ist. Dass militärischer Drill, ‚Exerzierdienst‘ und Waffenappelle kaum dazu beigetragen haben dürften, die Polizei der Weimarer Republik zu einer modernen, professionellen, demokratischen Organisation zu entwickeln, 1161 Vgl. hierzu http://web.archive.org/web/20091027102005/http://geocities.com/~ orion47/ WEHRMACHT/HEER/Generalleutnant/GILBERT_MARTIN.html (Zugriff: 12.2.2018); http://www.lexikon-der-wehrmacht.de/Personenregister/G/Gilbert M.htm (Zugriff: 12.2.2018). 1162 Vgl. Ivie, Garland, Stress and Burnout in Policing, S. 49ff.; Clark, The Importance of a New Philosophy, S. 642ff.; Hodgson, Police Violence, S. 520ff. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 329 muss den zuständigen politischen Entscheidungsträgern um den preußischen Ministerpräsidenten Otto Braun und seinen Innenministern Carl Severing sowie Albert Grzesinski zweifelsohne bewusst gewesen. Die Widersprüche zwischen der von ihnen propagierten Demokratisierung der Polizei und den von den für die Polizeiausbildung zuständigen Polizeioffizieren in dieser führenden polizeilichen Fachzeitschrift publizierten Beiträgen waren so offensichtlich, dass sie ihnen kaum entgangen sein dürften. Dennoch unternahmen sie keine entscheidenden Schritte zur Behebung dieser Entwicklung, so dass Zweifel an der Ernsthaftigkeit der von ihnen propagierten Forderungen nach einer demokratischen, entmilitarisierten und verbürgerlichten Polizei angebracht sind.1163 Verbesserung der Anstellungs- und Versorgungsbedingungen Die Modernisierung und Professionalisierung der Polizei in den mittleren Jahren der Weimarer Republik spiegelte sich schließlich auch in der Personalpolitik und insbesondere in den Anstellungs- und Versorgungsbedingungen der Schutzpolizeiangehörigen wider. Ein zentrales Problem war dabei der beamtenrechtliche Status der Schutzpolizeiangehörigen, der lediglich für die Offiziere eine lebenslängliche Verbeamtung, für den überwiegenden Teil der Schutzpolizeibeamten des Wachtmeisterkorps – Peter Leßmann-Faust spricht für Zeit bis 1927 von 43.000 der 49.600 Wachtmeister, d. h. ca. 87%1164 – aber nur eine zwölfjährige Verbeamtung auf Zeit vorsah. Eine anschließende Übernahme in ein unbefristetes Beamtenverhältnis in der Polizei oder anderen Bereichen des öffentlichen Dienstes war zwar grundsätzlich möglich, allerdings nur, wenn dort Stellen verfügbar waren.1165 Dies führte dazu, dass aufgrund der Anrechnung von Kriegsdienstzeiten in der zweiten Hälfte der 1920er Jahre zahlreiche Schutzpolizeibeamten aus dem Polizeidienst ausscheiden mussten, die angesichts ihres polizeilich geprägten, für andere Arbeitgeber eher uninteressanten Qualifikationsprofils und der weiterhin schwierigen volkswirtschaftlichen Rahmenbedingungen schlechte Aussichten auf eine angemessene Beschäftigung hatten, daher oftmals langzeitarbeitslos wurden und deren Situatif) 1163 Vgl. Leßmann-Faust, Weimarer Republik, S. 39 f.; Leßmann, Mit Manneszucht, S. 87 f.; Leßmann-Faust, Die Preußische Schutzpolizei, S. 214ff.; Bessel, Policing, S. 200 f. 1164 Vgl. Leßmann-Faust, Die Preußische Schutzpolizei, S. 131. 1165 Vgl. Leßmann-Faust, Die Preußische Schutzpolizei, S. 106ff. IV. Die deutsche Polizei in der Zwischenkriegszeit 330 on dann nach dem Ausbruch der Weltwirtschaftskrise im Jahr 1929 und der Implementierung einer strikten Deflationspolitik1166 unter Reichskanzler Heinrich Brüning ab 1930 dann geradezu hoffnungslos wurde. In der ZDPol wurden Anstellungs-, Besoldungs- und Versorgungsfragen ab Mitte der 1920er Jahre zunehmend thematisiert, was darauf hindeutete, dass diese Themen an praktischer Relevanz gewannen und daher auch in Polizeikreisen in den Mittelpunkt der Diskussion rückten. Dies belegte beispielsweise der Bericht des Polizeisekretärs Ernst Hildebrandt über den Parlamentarischen Abend, den die Arbeitsgemeinschaft Preußischer Polizeibeamtenverbände im März 1926 im Großen Festsaal des Preußischen Landtages organisiert hatte und auf an dem sich über 200 Personen – im Wesentlichen Parlamentarier sowie leitende Polizei- und Ministerialbeamte – beteiligten.1167 Der Beitrag fasste u. a. zwei der dort gehaltenen Reden zusammen. Den Anfang machte die Rede von Ernst Schrader, dem Vorsitzenden des auch als ‚Schrader-Verband‘ bezeichneten Verbandes Preußischer Polizeibeamten e. V., der „wirkmächtigeste[n] Polizeigewerkschaft in Preußen und im gesamten Reich“.1168 Dabei wies er zunächst „auf die Nöte und Wünsche aller Polizeibeamten hin, deren wirtschaftliche und beamtenrechtliche Lage trotz anerkennenswerter Besserung im Vorjahre immer noch drückend und beängstigend ist“1169, bevor er dann eine ganze Reihe von politisch-rechtlichen Maßnahmen vorschlug, die zu einer Lösung dieser Probleme beitragen könnten. Eine sehr konkrete Problembeschreibung lieferte dann die Rede des Ministerialdirektors und späteren Staatssekretärs im Preußischen Innenministerium Wilhelm Abegg: „Zwei Dinge, betont Abegg, sind es unter denen die Schutzpolizei besonders leidet 1. Die schlechte Besoldung. 2.Der Umstand, daß der Polizeibeamte nach 12jähriger Dienstzeit entlassen wird.“1170 1166 Vgl. z. B. Thoß, Demokratie ohne Demokraten, S. 140ff. 1167 Vgl. E. Hildebrandt, Um die Zukunft der Polizeibeamten – Eine Kundgebung im Preußischen Landtag, in: ZDPol, 23. Jg. (1926), Nr. 6 (20.3.1926), S. 135 f. 1168 Vgl. M. Reuter, Die Gleichschaltung der preußischen und deutschen Polizeigewerkschaften im Nationalsozialismus, Frankfurt a. M. 2014, S. 19ff. (Zitat: S. 19). 1169 Hildebrandt, Um die Zukunft der Polizeibeamten (20.3.1926), S. 135. 1170 Hildebrandt, Um die Zukunft der Polizeibeamten (20.3.1926), S. 136. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 331 Daran schlossen sich einige Ausführungen an, in denen er sich mit Lösungsansätzen für diese Problematik beschäftigte und die – wenig überraschend – in Kern auf eine Erhöhung der Anzahl an lebenslänglichen Stellen sowie der Besoldung hinausliefen. Die Schwierigkeiten, die bei der politischen Umsetzung dieser Maßnahmen zu erwarten waren, sprach er aber auch sehr deutlich an: „Und wie ist eine Hebung zu erreichen? Das Finanzministerium, das schließlich die letzte Entscheidung hat, befindet sich in einer schwierigen Lage. Denn es werden alle anderen Beamtenkategorien kommen und gleiche Besserstellungen verlangen. Der Polizeibeamtenberuf ist der vornehmste, wichtigste, der verantwortungsvollste, den es zurzeit gibt, und deshalb ist eine Sonderstellung der Polizei berechtigt.“1171 Auch hier wird deutlich, dass Mitte der 1920er Jahre die knappe Haushaltslage ein zentrales Hindernis bei der Weiterentwicklung der Polizei im Allgemeinen und bei der Verbesserung der Versorgung der Polizeibeamten im Besonderen darstellte. Die ‚Lobeshymne‘ auf den Polizeiberuf im letzten Satz war wohl dem Umstand geschuldet, dass die Rede auf einer von Polizeibeamtenverbänden organisierten Veranstaltung gehalten wurde, so dass zahlreiche leitende Polizeibeamte bzw. Polizeioffiziere anwesend waren. Auch wenn die darin geäußerte Auffassung beim Publikum zweifelsohne auf breite Zustimmung gestoßen sein dürfte, so ist doch davon auszugehen ist, dass den meisten Zuhörern zugleich bewusst war, dass das preußische Finanzministerium dieses Argument wenig überzeugend finden und dem Polizeiberuf mit hoher Wahrscheinlichkeit keine besoldungs- und versorgungsrechtliche Sonderstellung einräumen würde. Insofern war angesichts der zu erwartenden Fortschreibung der unbefriedigenden Besoldungs- und Versorgungsverhältnisse von einer erheblichen, nachhaltigen Unzufriedenheit innerhalb der Polizeibeamtenschaft auszugehen, die nicht ohne Folgen für das Engagement und die Leistungsmotivation der Belegschaft bleiben konnte. Zugleich verschwieg Wilhelm Abegg in seiner Rede aber nicht, dass auch auf ministerieller Seite eine gewisse Unzufriedenheit mit der Polizei anzutreffen war. So schloss er seine Rede mit der folgenden, dezent formulierten, aber dennoch deutlich erkennbaren Kritik: „Am Schluß seiner Rede erklärte Ministerialdirektor Dr. Abegg, daß der Beamte, wenn er fordert, auch Pflichten zu erfüllen habe, und diese Pflicht ist in erster Linie Treue zum Staat und Treue zur deutschen 1171 Hildebrandt, Um die Zukunft der Polizeibeamten (20.3.1926), S. 136. IV. Die deutsche Polizei in der Zwischenkriegszeit 332 Republik. Dieses muß aus innerster Überzeugung kommen und wenn heute im republikanischen Staate noch nicht alles erreicht ist, was erreicht werden sollte, dann müssen gerade diejenigen, die der Meinung sind, daß unser Volk, unser Land in Not ist, es für die vornehmste Aufgabe ansehen, diesem Staat und diesem Volk aus der Not zu helfen. Die Rede Abeggs wurde mit stürmischem Beifall aufgenommen. Als nach ihm der demokratische Reichstagsabgeordnete Schuldt den letzten Gedanken aufnahm und seine Rede mit einem glühenden Bekenntnis zur Republik schloß, stimmten die Versammelten begeistert ein und gaben dadurch wieder den Beweis, daß die Preußische Polizei, die Polizei Severing-Abegg, die beste Gewähr für die Erhaltung der Republik und ihre sicherste Stütze ist.“1172 Die von ihm hier gewählte, unmissverständliche Formulierung, dass man nur Forderungen stellen kann, wenn man auch seine Pflichten erfüllt, gefolgt von dem Hinweis auf die „Treue zum Staat und Treue zur deutschen Republik“, die für einen Beamten eigentlich eine Selbstverständlichkeit darstellen sollte, und der Aufforderungen, „dem Volk aus der Not zu helfen“, konnte von den Anwesenden nur als Kritik an der Zuverlässigkeit, Motivation und Solidarität der Polizei verstanden werden. Insofern dürften vor allem die anwesenden Polizeibeamten von diesem Abschluss der Rede alles andere als begeistert gewesen sein, so dass der „stürmische Beifall“ – wenn es ihn tatsächlich gab – vermutlich weniger von diesem Teil des Publikums und vielmehr von den anwesenden Parlamentariern und Ministerialbeamten ausgegangen sein dürfte. Dies galt angesichts dieser kritischen Worte und der traditionell rechtskonservativen Gesinnung der Polizeioffiziere sicherlich auch für die Begeisterung, die dem „glühenden Bekenntnis zur Republik“ des DDP-Abgeordneten Otto Schuldt entgegenschlug, so dass erhebliche Zweifel angebracht sind, ob man daraus tatsächlich einen „Beweis“ für die Republiktreue und demokratische Gesinnung der preußischen Polizei ableiten konnte. Die absehbaren Schwierigkeiten, die Besoldungs- und Versorgungslage der Polizei nachhaltig zu verbessern, zeigten sich dann ein Jahr später, d. h. 1927, als mit dem neuen Polizeibeamtengesetz erstmalig eine einheitliche Regelung der Rechtsstellung aller preußischen Polizeibeamten beschlossen wurde. Dieses beinhaltete zwar eine eindeutige Verbesserung der Versorgungslage von neu bzw. ab 1926 eingestellten Polizeibeamten, die nach zwölf Jahren nur noch auf eigenen Wunsch entlassen werden konnten und 1172 Hildebrandt, Um die Zukunft der Polizeibeamten (20.3.1926), S. 136. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 333 ansonsten unbefristet verbeamtet wurden. Für die bereits in der Schutzpolizei beschäftigten Beamten ergab sich jedoch keine nennenswerte Verbesserung im Vergleich zur vorherigen, von vielen Berufsangehörigen als äu- ßerst unbefriedigend empfundenen Regelung. Die enorme Brisanz dieser Thematik zeigt sich nicht zuletzt darin, dass der preußische Innenminister Albert Grzesinski sowie sein Mitarbeiter Ernst van den Bergh – Ministerialrat und späterer Leiter des Preußischen Polizei-Instituts – im März 1927 zwei Artikel in der ZDPol veröffentlichten, in denen sie die Entstehung, den Inhalt und die voraussichtlichen Auswirkungen des in ihrem Ministerium erarbeiteten Entwurfs des Polizeibeamtengesetzes erörterten.1173 Darin erläuterte Albert Grzesinski zunächst die Ursachen für die bisherige Regelung, d. h. die zwölfjährige Verbeamtung auf Zeit, indem er auf die außergewöhnlichen Entstehungsbedingungen der preußischen Schutzpolizei in den ersten beiden Nachkriegsjahren verwies, in denen eine Polizei entstand, die im Wesentlichen aus ehemaligen Kriegsteilnehmern und ehemaligen Angehörigen der Kaiserlichen Schutzmannschaft bestand: „Zunächst war es aber nicht leicht, diesen großen und nicht organisch gewachsenen Beamtenkörper in die übrige Beamtenschaft einzufügen. Für eine längere Übergangszeit war es rein zahlenmäßig nicht möglich, die übermäßig starken älteren Jahrgänge lebenslänglich in die übrige Polizei ganz zu übernehmen. Eine mit den Aufgaben der neuzeitlichen Polizei nicht zu vereinbarende starke Überalterung bis in die geschlossenen Formationen hinein, sowie das Stocken des Nachwuchses und des Aufrückens für lange Jahre wäre die Folge gewesen. Eine solche Entwicklung entspräche weder den dringenden staatlichen Notwendigkeiten, noch den Interessen der gesamten Polizeibeamtenschaft.“1174 Das hier angeführte Argument der Überalterung, das auch in anderen Beiträgen genannt wurde und sich auch bereits im 1922 beschlossenen Reichsrahmengesetz über die Schutzpolizei der Länder fand1175, zeugte von einem bemerkenswerten strategischen Weitblick der damaligen politischen Entscheidungsträger, die kurzfristig durchaus absehbare, erhebliche negative Auswirkungen auf die Arbeitszufriedenheit und Motivation der 1173 Vgl. A. Grzesinski, Das neue Polizeibeamten-Gesetz, in: ZDPol, 24. Jg. (1927), Nr. 5 (5.3.1927), S. 97ff.; E. van den Bergh, Das Polizeibeamtengesetz in seiner Bedeutung für die Polizei, in: ZDPol, 24. Jg. (1927), Nr. 5 (5.3.1927), S. 99ff. 1174 Grzesinski, Das neue Polizeibeamten-Gesetz (5.3.1927), S. 97. 1175 Vgl. Leßmann-Faust, Die Preußische Schutzpolizei, S. 112 f. und S. 115 f. IV. Die deutsche Polizei in der Zwischenkriegszeit 334 Polizeibeamten in Kauf nahmen, um langfristig eine Überalterung der Polizei zu vermeiden und sich eine gewisse personalpolitische Flexibilität zu erhalten. Die in den ersten Nachkriegsjahren eingestellten Schutzpolizisten sollten also nicht dauerhaft in der Polizei verbleiben, sondern diese spätestens nach zwölf Jahren wieder verlassen. Diese auf die einmaligen Rahmenbedingungen in den ersten Nachkriegsjahren abgestimmte Verfahrensweise sollte aber nicht dauerhaft beibehalten werden, sondern nach einigen Jahren durch eine den allgemeinen beamtenrechtlichen Vorgaben entsprechende ersetzt werden, da von einem Lebenszeitbeamten eher ein berechenbares, loyales, rechtlich einwandfreies polizeiliches Handeln zu erwarten war als von einem befristet beschäftigten Schutzpolizisten.1176 Im Jahr 1927 fand diese beamtenrechtliche Normalisierung dann statt. Allerdings hatte sich in Bezug auf die personalpolitische Zweckmäßigkeit des Ausscheidens der in den ersten Nachkriegsjahren eingestellten Schutzpolizisten nichts geändert, so dass konsequenterweise an der bisherigen Regelung festgehalten wurde, auch wenn absehbar war, dass das Ausscheiden aus dem Polizeidienst für viele Beamte mit enormen Schwierigkeiten verbunden sein würde. Diese Konsequenz sowie die Tatsache, dass dies zu erheblichen Verstimmungen innerhalb der Belegschaft der Polizei führen würde, waren den politischen Entscheidungsträgern und damit auch dem Autor dieses Beitrags als preußischen Innenminister sicherlich klar. Gleichwohl erwähnte er sie in seinem Beitrag nur knapp, ziemlich vage und auch auf eine etwas irreführende Weise: „Zwar sind die starken älteren Jahrgänge noch nicht aufgebraucht, und es muß im Interesse der Gesamtpolizei noch die Möglichkeit bestehen bleiben, den Teil dieser älteren Beamten, der zahlenmäßig in die inzwischen in großer Zahl geschaffenen unkündbaren Stellen der Schutzpolizei und in die übrige Polizei nicht übernommen werden kann, wie bisher durch eine ausreichende Versorgung abzufinden.“1177 Die gewählte Formulierung erweckte den Eindruck, dass nur ein eher kleiner Teil der Belegschaft der Polizei entlassen werden musste und dass für diesen Personenkreis weiterhin eine „ausreichende Versorgung“ gewährleistet werden konnte. Tatsächlich war aber der weitaus größte Teil der Polizeibeamten betroffen, und die ihnen zustehenden staatlichen Versorgungsleistungen, die im Wesentlichen aus einmaligen Übergangsbeihilfen und einem oftmals wertlosen ‚Polizeiversorgungsschein‘ bzw. alternativ da- 1176 Vgl. Leßmann-Faust, Die Preußische Schutzpolizei, S. 106. 1177 Grzesinski, Das neue Polizeibeamten-Gesetz (5.3.1927), S. 97. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 335 zu einer einmaligen Kapitalabfindung bestanden, waren in der Regel unzureichend.1178 Insofern verwundert es nicht, dass der Gesetzentwurf bereits unmittelbar nach seinem Bekanntwerden auf massive Kritik stieß. Der preußische Innenminister versuchte in seinem Beitrag dieser auch in der Presse geäußerten Kritik entgegenzuwirken, indem er feststellte: „Es trifft nicht zu, wie teilweise in der Presse behauptet wurde, daß durch diese Bestimmungen das bisherige System in verschleierter Form wieder eingeführt werden soll. Gerade das Gegenteil ist der Fall: Nach dem bisherigen System wurden die Beamten nach 12 Dienstjahren ‚in der Regel‘ entlassen, während künftig eine Entlassung von Schutzpolizeibeamten nach 12 Dienstjahren, wenn überhaupt, nur in ganz vereinzelten Ausnahmefällen stattfindet. […] Der Entwurf des Polizeibeamtengesetzes bedeutet demnach gegenüber dem bisherigen Zustande einen wesentlichen Fortschritt.“1179 Auch wenn Albert Grzesinski formal richtig argumentierte, weil die neue Regelung für neu eingestellte Polizeibeamte in der Tat eine deutliche Verbesserung der Versorgungslage bedeutete, so konnte der von ihm hier festgestellte „wesentliche Fortschritt“ zwar aus der politischen Perspektive eines Ministers, aber sicherlich kaum aus der Perspektive der von Zukunfts- ängsten geplagten, gegenwärtigen Belegschaft der Polizei, die einen Großteil der Leserschaft dieser Zeitschrift stellte, nachvollzogen werden. Vielmehr ist davon auszugehen, dass die in diesem Beitrag gewählte Darstellung der Versorgungslage in der Weimarer Polizei, die die existenziellen Sorgen und Nöte einer Vielzahl von Polizeibeamten weitgehend ignorierte, durchaus geeignet gewesen sein dürfte, die ohnehin vorhandene Unzufriedenheit in der Belegschaft weiter zu steigern. Gleichwohl nahm der preußische Innenminister diese bewusst in Kauf, wobei aber unklar blieb, ob er dies ausschließlich aufgrund der schwierigen fiskalischen Rahmenbedingungen oder zur Vermeidung einer Überalterung der Schutzpolizei oder aus anderen Gründen tat. Vor dem Hintergrund der weiter oben besprochenen, ein Jahr zuvor in dieser Zeitschrift publizierten Zweifel an der „Treue zum Staat und Treue zur deutschen Republik“1180 der Polizeibeamtenschaft erscheint es auch durchaus plausibel, dass er darin auch eine Chance sah, die Schutzpolizei personell zu erneuern und auf diese Weise die bis dahin mäßig erfolgreiche Demokratisierung der Polizei ‚von oben‘ 1178 Vgl. Leßmann-Faust, Die Preußische Schutzpolizei, S. 118ff. 1179 Grzesinski, Das neue Polizeibeamten-Gesetz (5.3.1927), S. 98. 1180 Hildebrandt, Um die Zukunft der Polizeibeamten (20.3.1926), S. 136. IV. Die deutsche Polizei in der Zwischenkriegszeit 336 langfristig voranzutreiben. Kurzfristig dürfte diese Reform und die Art und Weise, wie Albert Grzesinski sie in diesem Beitrag seinen Lesern ‚verkaufte‘, sich aber eher negativ auf die Zuverlässigkeit, Arbeitszufriedenheit und Leistungsbereitschaft der Schutzpolizei ausgewirkt haben. Dass man auch eine andere, vermutlich etwas gelungenere Art und Weise wählen konnte, die Auswirkungen des Polizeibeamtengesetzes zu erörtern, zeigte der in der gleichen Ausgabe der ZDPol veröffentlichte Beitrag von Ernst van den Bergh, der als Ministerialrat ebenfalls im preußischen Innenministerium arbeitete, der aber im Gegensatz zu seinem Minister wesentlich besser auf die Belange der Leserschaft dieser Zeitschrift einging. Darin erklärte er zwar zunächst wahrheitsgemäß und in völligem Einklang mit den Ausführungen seines Innenministers Albert Grzesinski die Ursachen für die ursprüngliche Befristung der Verbeamtung von Schutzpolizisten auf zwölf Jahre, nämlich insbesondere die Gefahr der Überalterung der Polizei, allerdings merkte er dann an: „Niemand, dem die Zukunft der Polizei am Herzen liegt, kann eine solche Entwicklung wünschen. Unvermeidliche Härten, die augenblicklich auftreten können, müssen dabei in Kauf genommen werden. Bei den zu treffenden Maßnahmen handelt es sich also nicht um eine gewaltsame ‚Verjüngung‘ der Polizei oder gar um eine bewußte Benachteiligung irgendeiner Beamtengruppe, sondern um eine Lebensfrage, die in allen ihren Folgen sorgfältig und nüchtern geprüft werden muß. […] Es ist aber schon zu übersehen, daß für eine auf 4-5 Jahre zu bemessende Übergangszeit eine beträchtliche Anzahl von Beamten noch in der bisherigen Weise aus der Schutzpolizei nach Vollendung der zwölfjährigen Dienstzeit ausscheiden muß […].“1181 Ernst van den Bergh sprach sowohl die „beträchtliche Zahl“ an Beamten, die damit rechnen musste, in den nächsten Jahren aus dem Polizeidienst ausscheiden und in eine Situation der beruflichen Unsicherheit eintreten zu müssen, als auch die „unvermeidlichen Härten“ für diesen Personenkreis ganz konkret an. Seine Formulierung im zweiten Satz verdeutlichte, dass er durchaus versuchte, sich in die Lage dieser lebensälteren und erfahrenen Polizeibeamten hineinzuversetzen, die durch jüngere, unerfahrene Kollegen ersetzt werden sollten und dies verständlicherweise als diskriminierend empfanden. Auch wenn er – wie sein Innenminister – keine zufriedenstellende Lösung für die Versorgungsproblematik anbieten konnte, so ist doch davon auszugehen, dass bereits die ehrliche Auseinander- 1181 van den Bergh, Das Polizeibeamtengesetz (5.3.1927), S. 100. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 337 setzung mit den Sorgen und Nöten der Polizeibeamten dazu beigetragen haben könnte, die davon ausgehenden negativen Motivationswirkungen zumindest etwas abzumildern. Dieser Effekt dürfte allerdings äußerst bescheiden ausgefallen sein, da den meisten Lesern dieses Beitrags nicht entgangen sein dürfte, dass Ernst van den Berghs Argumentation strenggenommen nicht schlüssig war und dass das Polizeibeamtengesetz von 1927 bei genauerer Betrachtung sehr wohl auf „eine gewaltsame ‚Verjüngung‘ der Polizei“ abzielte und „eine bewußte Benachteiligung [einer] Beamtengruppe“ darstellte. Der einzige denkbare Lösungsansatz für die Problematik wäre eine deutliche Erhöhung der der Polizei zur Verfügung gestellten Ressourcen in Form eines deutlichen Ausbaus des Personalbestands oder von deutlich erhöhten Versorgungsleistungen gewesen, was aber angesichts der schwierigen fiskalischen Rahmenbedingungen zu diesem Zeitpunkt so unrealistisch erschien, dass diese Möglichkeiten in den Beiträgen nicht einmal thematisiert wurden. Insgesamt muss man daher festhalten, dass in den mittleren Jahren der Weimarer Republik auch im beamten- bzw. versorgungsrechtlichen Bereich – insbesondere mit dem Polizeibeamtengesetz von 1927 – eine Modernisierung und Professionalisierung stattfand. Hiervon profitierten allerdings vor allem die ab 1926 neu in den Polizeidienst eingestellten Beamten, während die lebensälteren Schutzpolizisten, die in den ersten Nachkriegsjahren eingestellt worden waren und in den durchaus turbulenten und gewaltsamen frühen Krisenjahren der Republik ihren psychisch und physisch äußerst belastenden Dienst versehen hatten, größtenteils davon ausgeschlossen blieben, aus der Polizei entlassen wurden und anschließend oftmals enorme Schwierigkeiten hatten, ihren Lebensunterhalt zu verdienen. Diese von der politischen Führung bewusst in Kauf genommene Entlassung von Zehntausenden Schutzpolizeibeamten in die Arbeitslosigkeit musste nicht nur von den unmittelbar Betroffenen, sondern auch von ihren im Dienst verbliebenen Kollegen als eine zwar legale, aber inhumane und daher unangemessene Verletzung der Fürsorgepflicht des Staates gegenüber seinem Beamtenkörper wahrgenommen werden und verheerende Auswirkungen nicht nur auf die Popularität der SPD-geführten preußischen Landesregierung, sondern auch auf die Integrität und die Zuverlässigkeit der Schutzpolizei haben. Peter Leßmann-Faust spricht daher in diesem Zusammenhang von einem „Versorgungsdebakel“, aus dem die Nationalsozialisten in den nun folgenden Jahren vor allem über einen eige- IV. Die deutsche Polizei in der Zwischenkriegszeit 338 nen Berufsverband, der ausschließlich ehemalige Polizeibeamte aufnahm, politisches Kapital schlagen konnten.1182 Imageoffensive des Streifendienstes Hinsichtlich der bereits erörterten Demokratisierungs-, Modernisierungsund Professionalisierungstendenzen in der deutschen Polizei in den ‚ruhigen‘ Jahren der Weimarer Republik erscheint es plausibel anzunehmen, dass sich diese nicht auf die institutionelle Entwicklung beschränken konnten, sondern sich auch in der alltäglichen, praktischen Polizeiarbeit widerspiegeln mussten. Dies müsste insbesondere für den polizeilichen Streifendienst gelten, der das Hauptbetätigungsfeld der Schutzpolizeibeamten darstellte und dessen zentrale Rolle und Bedeutung für den polizeilichen Erfolg der Berliner Polizeipräsident Karl Zörgiebel in einem im April 1929 in der ZDPol publizierten Beitrag explizit hervorhob, indem er feststellte: „Und darauf möchte ich noch einmal hinweisen, der Dienst der Schutzpolizeibeamten ist in erster Linie Straßenaufsichtsdienst. […] Der Erfüllung der großen polizeilichen Aufgaben dient vor allem der Beamte auf der Straße; die anderen versehen Hilfsdienst.“1183 Gerade vor dem Hintergrund der weiter oben für die Anfangsjahre der Weimarer Republik festgestellten Akzeptanzdefizite der Schutzpolizeibeamten im Streifendienst erscheinen Modernisierungs-, Professionalisierungs- und Demokratisierungsprozesse auch in diesen Tätigkeitsbereich dringend geboten. Zu Beginn des Jahres 1924 hatte sich am mangelnden Rückhalt der Polizei in der Bevölkerung offensichtlich nicht viel geändert, wie ein im Januar 1924 vom Bremer Polizeiwachtmeister Alfred Schulz in der ZDPol veröffentlichter Beitrag zur Einführung des Gummiknüppels als Ersatz für den bis dahin noch üblichen Säbel verdeutlichte.1184 Diesen Ersatz lehnte der Autor mit der Begründung ab, dass dieses Vorgehen zwar g) 1182 Vgl. Leßmann-Faust, Geschichte der Polizei, S. 23 f. (Zitat: S. 24); Leßmann- Faust, Die Preußische Schutzpolizei, S. 106ff., S 260ff. und zum ‚Verband ehemaliger Polizeibeamter Preußens‘ insb. S. 267ff. 1183 K. Zörgiebel, Mehr Beamte auf die Straße! in: ZDPol, 26. Jg. (1929), Nr. 7 (5.4.1929), S. 156. 1184 Vgl. A. Schulz, Ist die Einführung eines Gummiknüppels als Ersatz des Säbels zweckmäßig? in: ZDPol, 20. Jg. (1923/24), Nr. 20 (20.1.1924), S. 340. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 339 in den USA und Großbritannien erfolgreich gewesen, im damaligen Deutschland aber nicht zweckmäßig sei. Hierzu führte er aus: „Allerdings, in den beiden angelsächsischen Staaten ist schon lange jede Waffe von der Straße verschwunden. […] Der Polizist ohne blanke Waffe ist eine altgewohnte Erscheinung. Er hat dort aber bedeutend höhere Machtbefugnisse und größere Autorität als bei uns. […] Dazu kommt, daß er jederzeit bei seinem Einschreiten auf die Unterstützung des Publikums rechnen kann. Bei uns dagegen kann man täglich beobachten, daß beim Einschreiten des Beamten auf der Straße das Publikum, das sich ja sogleich in großer Zahl versammelt, ohne auch nur die geringste Ahnung von dem Grunde zu haben, sich auf die Seite des Beschuldigten stellt und Partei gegen den Beamten ergreift. […] Die augenblicklichen Zeiten erfordern für die Polizei einen zum Nahkampf geeigneten kurzen Säbel, wie er hier in Bremen bei den Beamten des Einzeldienstes im Gebrauch ist.“1185 Wenig überzeugend wirkten seine Ausführungen zur Sicherheitslage und zu den Machtbefugnissen der englischen und amerikanischen Polizeibeamten in den ersten beiden zitierten Sätzen. Ihre Befugnisse dürften sich nicht wesentlich von denjenigen ihrer deutschen Kollegen unterschieden haben, und die Vorstellung, dass in den USA im Jahre 1924 „schon lange jede Waffe von der Straße verschwunden“ sein könnte, war geradezu abwegig und ließ eher vermuten, dass Alfred Schulz die tatsächliche Sicherheitslage und die Verbreitung von Waffen in den USA überhaupt nicht einschätzen konnte. Wesentlich glaubwürdiger wirkten hingegen seine Ausführungen zu den Beziehungen zwischen der deutschen Polizei und der Bevölkerung, die seiner Darstellung nach äußerst angespannt waren. Auch wenn seine Anmerkung, dass Konflikte zwischen Streifenbeamten und dem Publikum „täglich“ vorkamen, möglicherweise etwas übertrieben war, so entsprachen seine Schilderungen des mangelnden Rückhalts der Polizei in der Bevölkerung insgesamt durchaus denjenigen in zahlreichen anderen Publikationen, die in den letzten Jahren in dieser Zeitschrift erschienen waren. Gleichwohl hätten den Lesern dieses Beitrags durchaus Zweifel an der daraus gezogenen Schlussfolgerung kommen können, dass ein Säbel, der im Falle seines Einsatzes schwere, potenziell tödliche Verletzungen verursachen konnte, tatsächlich im Streifendienst unverzichtbar war. Schließlich wurden Streifenbeamten in ihrem Arbeitsalltag – damals 1185 Schulz, Ist die Einführung eines Gummiknüppels zweckmäßig? (20.1.1924), S. 340. IV. Die deutsche Polizei in der Zwischenkriegszeit 340 wie heute – nur relativ selten direkt mit Gewalt konfrontiert, während der weit überwiegende Teil ihrer Arbeitszeit auf unspektakuläre Routinetätigkeiten wie die Erteilung von Auskünften oder Verkehrsunfallaufnahmen entfiel. Zudem verfügten Polizeibeamte damals bereits flächendeckend über Pistolen, die im ‚Ernstfall‘ sicherlich wirkungsvoller als ein Säbel waren.1186 Naheliegender erscheint doch die Annahme, dass das Plädoyer des Autors für die Beibehaltung des Säbels eher durch dessen Funktion als traditionelles, organisationskulturell verankertes Symbol polizeilicher Stärke mit einer entsprechend starken Beharrungstendenz zu erklären ist.1187 Die von mit Säbeln ausgestatteten Streifenbeamten ausgehende, tendenziell sicherlich einschüchternde und abschreckende Wirkung dürfte den Rückhalt der Polizei in der Bevölkerung jedoch eher geschmälert haben. Dass diese Problematik in der damaligen Polizei durchaus erkannt wurde, zeigte der nur sechs Wochen später am 5. März 1924 in der ZDPol publizierte Kurzbeitrag des thüringischen Polizeioberst Müller, der explizit Bezug nahm auf den Artikel von Alfred Schulz und die darin enthaltene Ablehnung der Einführung des Gummiknüppels als Ersatz für den Säbel und hierzu kritisch anmerkte: „Ich möchte aber doch davor warnen, die Frage einfach zu den Akten zu legen, denn die Erfahrungen mit dem Polizeiknüppel, die in Thüringen gemacht worden sind, sprechen für diese Waffe. Die Thüringische Landespolizei wird im Straßendienst mit Polizeiknüppel im Köcher und Pistole ausgerüstet. Die bisher gemachten Erfahrungen beweisen, daß der Polizeiknüppel in vieler Beziehung dem Säbel vorzuziehen ist. Auch beim geschlossenen Einsatz gegen radaulustige Mengen hat der Gummiknüppel sich ganz ausgezeichnet bewährt. […] Dabei hat die Waffe den Vorzug, verhältnismäßig human zu sein, trotzdem aber sehr nachhaltig zu wirken.“1188 Der Autor stellte hier zum einen auf die Funktionalität des Gummiknüppels ab, die seiner Einschätzung nach angesichts der von der Thüringischen Polizei gemachten Erfahrungen höher war als die des Säbels. Zum anderen betonte er aber auch den „verhältnismäßig human[en]“ Charakter 1186 Vgl. Liang, Die Berliner Polizei, S. 65,. 1187 Vgl. M. Sturm, ‚Der knackt jeden Schädel‘ – Überlegungen zur Verwendung des Polizeischlagstocks“, in: WerkstattGeschichte o. Jg. (2006), Nr. 43, S. 103ff.; Schmidt, Schützen und Dienen, S. 386. 1188 Müller, (Vorname fehlt), Bemerkungen zur Frage der Einführung des Gummiknüppels als Ersatz des Säbels, in: ZDPol, 20. Jg. (1923/24), Nr. 23 (5.3.1924), S. 400. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 341 dieser Waffe, was man wohl als Indiz dafür sehen konnte, dass er sich auch der symbolischen Bedeutung sowohl des Gummiknüppels als auch des Säbels und der davon ausgehenden Wirkungen auf die Bevölkerung bewusst war. Wenn man zudem berücksichtigt, dass der Autor als Polizeioberst dem traditionell eher konservativen Offizierskorps angehörte und eine hohe hierarchische Position in der Thüringischen Polizei innehatte, dann kann man sein Plädoyer für den Gummiknüppel als Ersatz des Säbels und seine ausdrückliche Kritik am Beitrag des Polizeiwachtmeisters Müller durchaus als Anzeichen für eine gewisse Sensibilisierung der Polizei für die Problematik ihrer geringen Akzeptanz in der Bevölkerung und die Notwendigkeit von geeigneten Gegenmaßnahmen interpretieren. Diese Einschätzung wurde in den folgenden Monaten und Jahren durch die Publikation von zahlreichen weiteren Beiträgen, die sich mit den Möglichkeiten der Verbesserung des Verhältnisses von Polizei und Bürger beschäftigten, in der ZDPol bestärkt. Gemeinsames Merkmal dieser Beiträge war die darin sehr deutlich geäußerte Forderung eines freundlicheren und insbesondere höflicheren Auftretens der im polizeilichen Streifendienst tätigen Beamten gegenüber der Bevölkerung, so dass man von einer Imageoffensive oder – wie Hsi-Huey Liang – einer „Kampagne um die Gunst der Bevölkerung“1189 sprechen könnte. So erschien bereits in der folgenden Ausgabe am 20. März 1924 ein Aufsatz des Leiters der Polizeischule in Hildesheim, Ludwig Bartels, der sich ausschließlich mit der Erteilung von Auskünften durch Streifenbeamte befasste und an mehreren Beispielen ausführlich und sehr anschaulich erläuterte, in welcher Form die Auskunft zu erfolgen hatte, um „gerade in solchen Fällen ganz besonders der stets bereite und zuvorkommende Helfer [zu] sein“, den die Bevölkerung erwartete.1190 Im Oktober 1925 erschien dann in dieser Zeitschrift ein ähnlicher Beitrag des Polizeisekretärs Becker mit dem Titel „Im Dienste der Öffentlichkeit“, der ausgehend von einem ausführlich dargestellten Beispiel eines Konflikts zwischen einem Streifenbeamten und einem angetrunkenen Bürger, der letztlich in einer gewaltsamen Auseinandersetzung und einer leichten Verletzung des Beamten mündete, analysierte, wie der Beamte sein Verhalten hätte optimieren können.1191 Interessant ist an dem Aufsatz 1189 Liang, Die Berliner Polizei, S. 91. 1190 Vgl. L. Bartels, Der Polizeibeamte im Streifendienst bei der Erteilung von Auskunft an das Publikum, in: ZDPol, 20. Jg. (1923/24), Nr. 24 (20.3.1924), S. 426 f. (Zitat: S. 427). 1191 Vgl. Becker, (Vorname fehlt), Im Dienste der Öffentlichkeit, in: ZDPol, 22. Jg. (1925), Nr. 13 (5.10.1925), S. 374 f. IV. Die deutsche Polizei in der Zwischenkriegszeit 342 insbesondere die Tatsache, dass der Autor das Verhalten des betreffenden jungen Polizeiwachtmeisters im Beispiel trotz der offensichtlichen Störung der öffentlichen Ordnung und der gegen ihn gerichteten physischen Gewalt dennoch als falsch oder zumindest äußerst unglücklich darstellte. So sprach dieser den angetrunkenen Bürger „in schroffem Befehlston“ an, mit einer „Kommandostimme“, die „durchaus nicht in das friedliche Bild des Verkehrs paßte“, und „in einem Tone, der durchaus geeignet war, auch Menschen in normalen Zustande zu reizen“1192. Damit suggerierte er, dass es ein solches Fehlverhalten gegenüber dem Bürger im polizeilichen Alltag nicht nur tatsächlich gab, sondern auch durchaus üblich war. Diese relativ deutliche Kritik am Verhalten der Polizeibeamten hob sich deutlich von den meisten anderen in den Vorjahren in der ZDPol publizierten Beiträgen zu diesem Thema ab, die – wie z. B. der weiter oben besprochene Aufsatz von Felix Freudenthal1193 – die Schuld für die Problematik eher bei der Bevölkerung sahen oder – wie z. B. der ebenfalls weiter oben behandelte Beitrag von Wilhelm Kleibömer1194 – auf jegliche Schuldzuweisung und Selbstkritik verzichteten. Am Ende des Beitrags fasste Becker die Fehler des in seinem Beispiel angeführten Polizeiwachtmeisters zusammen und erläuterte, wie sich ein Streifenbeamter in einer solchen Situation verhalten sollte. „Es ist deshalb doppelt notwendig, daß der junge Beamte, der sich immer bewußt sein muß, alle seine Amtshandlungen gegebenenfalls vor dem Richter vertreten zu müssen, jeder Lage gewachsen bleibt und nicht, wie im vorliegenden Falle, durch unsachliches und schroffes Vorgehen dort zu imponieren versucht, wo es durchaus nicht angebracht ist. Nichts ist verkehrter als die Beachtung von Kleinigkeiten, die oft absichtlich herbeigeführt werden, wenn dadurch die Ordnung nicht gestört wird. Wo aber eingeschritten werden muß, da hat dies fest, aber ruhig und sachlich zu geschehen. Hier, wie in ähnlichen geringfügigen Anlässen wäre ruhiges, bestimmtes Vorgehen, vielleicht auch mit etwas Witz und Humor vereint, allein geeignet, zum Ziele zu führen. Gute Haltung, äußerste Ruhe und Überlegung, vorbildliche Höflichkeit jedem Menschen gegenüber, sei er im Frack oder im beschmutzten Arbeitskleid, und Energie zur rechten Zeit und am rechten Ort, die aber nicht gleichbedeutend ist mit Grobheit, zeichnen den 1192 Becker, Im Dienste der Öffentlichkeit (5.10.1925), S. 374. 1193 Vgl. Freudenthal, Der Schutz der Polizeibeamten (5.3.1921), S. 537. 1194 Vgl. Kleibömer, Die Schutzpolizei und die öffentliche Meinung (5.3.1924), S. 399 f. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 343 fertigen Polizeibeamten aus. Schroffes und barsches Vorgehen sind immer Zeichen von Hilflosigkeit, Mangel an Takt, Erziehung und Selbstdisziplin.“1195 Auffällig war auch hier erneut die Deutlichkeit, mit der das Verhalten des Polizeibeamten kritisiert wurde, wobei vor allem der Hinweis auf die mögliche gerichtliche Überprüfung eines polizeilichen Fehlverhaltens sicherlich von der überwiegend aus Polizeibeamten bestehenden Leserschaft als eher drastische Form der Kritik empfunden werden musste. Zugleich empfahl der Autor bei geringfügigen Störungen der öffentlichen Ordnung ein möglichst deeskalatives, defensives Vorgehen des Streifenbeamten, indem diesen mit Nichtbeachtung oder Humor begegnet und auf eine Ahndung verzichtet wurde. Gerade die Deutlichkeit, mit der die Kritik und diese Forderungen vom Autor geäußert wurden, sollte hervorgehoben werden, da diese bei der im Wesentlichen aus Polizeibeamten bestehenden Leserschaft keinesfalls auf ungeteilte Zustimmung gestoßen sein dürfte. Angesichts der – damals wie heute – von Streifenbeamten im Alltag oftmals erfahrenen Respektlosigkeiten und bewussten Provokationen durch ‚Ruhestörer‘ dürfte gerade die im letzten Satz vorgenommene Wertung von schroffem polizeilichem Vorgehen als „Zeichen von Hilflosigkeit, Mangel an Takt, Erziehung und Selbstdisziplin“ von vielen Lesern vielmehr als Affront empfunden worden sein. Da es wenig wahrscheinlich erscheint, dass dies dem Autor nicht bewusst war, muss dieser Beitrag sicherlich als deutlicher Hinweis interpretiert werden, dass die auf der politischen Ebene beschlossene, bereits oben erörterte Demokratisierung ‚von oben‘ und stärkere Bürgerorientierung der Polizei auch auf der operativen Ebene umgesetzt werden sollte. Für die Beamten im Streifendienst ergab sich daraus die Notwendigkeit, dem Bürger gegenüber höflich und zuvorkommend zu sein. Auch wenn man Hsi-Huey Liang zustimmen muss, dass dies eher ein Werben um öffentliche Anerkennung und „Demokratie [nicht] einfach mit Popularität gleichzusetzen“ sei1196, so stellte dies aber dennoch einen notwendigen und wichtigen Schritt hin zu einer demokratischeren, von der Bevölkerung stärker akzeptierten Polizei dar. Der Höhepunkt der Imageoffensive wurde dann im Spätsommer 1926, d. h. im Vorfeld der bereits weiter oben thematisierten Großen Polizeiausstellung in Berlin, erreicht, als gleich zwei sehr ausführliche Beiträge erschienen, die offensichtlich und plakativ auf ein bürgerorientierteres, 1195 Becker, Im Dienste der Öffentlichkeit (5.10.1925), S. 375. 1196 Vgl. Liang, Die Berliner Polizei, S. 91 f. (Zitat: S. 91). IV. Die deutsche Polizei in der Zwischenkriegszeit 344 freundlicheres Verhalten von Streifenbeamten gegenüber der Bevölkerung abzielten.1197 Eine besonders ausführliche Auseinandersetzung mit diesem Thema bot der im August 1926 in zwei Teilen in der ZDPol erschienene Aufsatz des Dresdner Polizeioberleutnants Otto Wolter mit dem Titel „Das Verhalten des Polizeibeamten im Straßendienst gegenüber der Bevölkerung“, der folgendermaßen begann: „Wenn eine Person oder deren Handlungen oft oder dauernd der Öffentlichkeit ausgesetzt sind, so ist es ein ganz natürlicher Vorgang, daß an beiden von den verschiedensten Seiten scharfe Kritik geübt wird. […] Das wenig beneidenswerte Los, fortwährend auf einem ‚Präsentierteller‘ gestellt zu sein, hat der Polizeibeamte des Außendienstes. Er verkörpert in seiner Person die Staatsautorität, und wie man ihn beurteilt, so beurteilt man schließlich auch seine Behörde und den Staat. Daraus erwächst für den Polizeibeamten die hohe, aber auch schwere Pflicht sich so zu bewegen, so zu handeln, daß niemand die Berechtigung zu einer abfälligen Kritik hat. Dem Staat leistet er damit den größten Dienst.“1198 Dabei betonte der Autor zunächst das zentrale Merkmal des polizeilichen Streifendienstes, nämlich dessen ständige Öffentlichkeit („Präsentierteller“). Diese erhöhte einerseits die Wahrscheinlichkeit von öffentlicher Kritik, andererseits machte sie den Streifenbeamten aber auch zum sichtbarsten Vertreter des Staates. Gerade dieser letztgenannte Aspekt verdeutlicht die Komplexität der politischen und gesellschaftlichen Funktion der Polizei, die nicht nur ein ‚willenloses‘ Herrschaftsinstrument in den Händen der politischen Machthaber ist, sondern durch ihr Auftreten und ihr Verhalten maßgeblich auf die Einstellungen der Bürger gegenüber dem Staat und seinen Institutionen einwirken kann. Angesichts der instabilen politischen Verhältnisse in der Weimarer Zeit und der ablehnenden Haltung eines Großteils der Bevölkerung zur damaligen Staatsform verwundert es daher nicht, dass die politische Führung so viel Wert auf eine Verbesserung des negativen Images der Polizei legte und von den Streifenbeamten so ve- 1197 Vgl. O. Wolter, Das Verhalten des Polizeibeamten im Straßendienst gegen- über der Bevölkerung, in: ZDPol, 23. Jg. (1926), Nr. 15 (5.8.1926), S. 397 f., Nr. 16 (20.8.1926), S. 423 f.; P. Riege, ‚Diener‘ der Gesamtheit – Ein Beitrag für die Erziehung zur Höflichkeit, in: ZDPol, 23. Jg. (1926), Nr. 18 (20.9.1926), S. 516ff. 1198 Wolter, Das Verhalten des Polizeibeamten im Straßendienst (5.8.1926), S. 397. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 345 hement ein Verhalten einforderte, das keinen Anlass „zu einer abfälligen Kritik“ bot. Im hier behandelten Beitrag versuchte Otto Wolter seiner sicherlich überwiegend aus streifendiensterfahrenen Polizeibeamten bestehenden Leserschaft in ausführlicher und systematischer Form Handlungsempfehlungen zu geben, die geeignet waren, das Image der Polizei – und damit indirekt auch des Staates – zu optimieren. Diese gliederten sich in vier Kapitel und umfassten (1) die äußere Erscheinung des Streifenbeamten („Tadellos gewaschen, rasiert und gekämmt zu sein, ist wohl Pflicht eines Polizeibeamten im ganz besonderen.“)1199, (2) sein Auftreten („Der Gang sei aufrecht und stramm. […] Der Blick sei nicht schlafmützig und gelangweilt.“)1200, (3) sein Einschreiten („Ruhe, Ruhe und nochmals Ruhe ist bei jedem Einschreiten die erste Bedingung.“)1201 und schließlich (4) sein Verhalten bei größeren Unruhen („Hierbei ist eine unerschütterliche Ruhe Hauptkampfmittel des Beamten.“)1202. Im Mittelpunkt seiner Ausführungen standen höfliches, freundliches und ordentliches Auftreten sowie bei Konflikten – wie im weiter oben behandelten Beitrag von Becker1203 – das Grundprinzip der Deeskalation. Obwohl Otto Wolter von Streifenbeamten auch Durchsetzungsstärke und, „wenn alles gütliche Reden nichts mehr hilft“, den Einsatz von Gewalt erwartete, so forderte er von ihnen im alltäglichen Umgang mit dem Bürger vor allem „Menschlichkeit“ in dem Sinne, dass Beleidigungen „zu überhören“ und „kleine Übertretungen [zu] übersehen“ seien.1204 In welchem Ausmaß solche Empfehlungen von den Streifenbeamten umgesetzt wurden und inwiefern sich dies tatsächlich in einer höheren Akzeptanz der Polizei in der Bevölkerung niederschlug, ist schwer einzuschätzen, allerding merkte der Autor hierzu an: „In Wirklichkeit ist [der Polizeibeamte] auch heute noch mehr ‚Angst‘als ‚Schutzmann‘. Wenn es auch schon in dieser Beziehung bedeutend besser geworden ist, so müssen wir doch immer noch viel Arbeit leis- 1199 Wolter, Das Verhalten des Polizeibeamten im Straßendienst (5.8.1926), S. 397. 1200 Wolter, Das Verhalten des Polizeibeamten im Straßendienst (5.8.1926), S. 397. 1201 Wolter, Das Verhalten des Polizeibeamten im Straßendienst (5.8.1926), S. 423. 1202 Wolter, Das Verhalten des Polizeibeamten im Straßendienst (5.8.1926), S. 424. 1203 Vgl. Becker, Im Dienste der Öffentlichkeit (5.10.1925), S. 374 f. 1204 Wolter, Das Verhalten des Polizeibeamten im Straßendienst (5.8.1926), S. 423 f. IV. Die deutsche Polizei in der Zwischenkriegszeit 346 ten, bis das Publikum merkt und fühlt, der Beamte will ihm helfen. Es kann sich also vertrauensvoll an ihn wenden.“1205 Offensichtlich waren die Beziehungen zwischen der Polizei und der Bevölkerung im Jahr 1926 nach Ansicht von Otto Wolter noch weit davon entfernt, als „vertrauensvoll“ bezeichnet werden zu können. Allerdings stellte dies die erste Publikation in der ZDPol dar, die in dieser Hinsicht von einer Verbesserung sprach. Während die zuvor zu dieser Thematik erschienenen Beiträge immer nur die geringe gesellschaftliche Akzeptanz der Polizei beklagten, meinte dieser Autor nun sogar „bedeutend[e]“ Fortschritte zu erkennen. Er spezifizierte zwar nicht den Zeitraum, auf den sich diese ‚Besserung‘ bezieht, aber es ist wohl davon auszugehen, dass er damit die letzten zwei bis drei Jahre – also die Zeit nach den turbulenten Anfangsjahren der Weimarer Republik – gemeint haben dürfte. Insofern könnte dies als erstes Indiz für eine möglicherweise eingetretene Verbesserung der Beziehungen zwischen Polizei und Bürger gewertet werden. Unterstützt wurde diese Interpretation durch eine ganze Reihe von weiteren Indizien in Beiträgen, die in der Folgezeit in der ZDPol publiziert wurden und ebenfalls der Imageoffensive des Streifendienstes zugerechnet werden können. So erschien bereits einen Monat später, im September 1926, ein solcher Aufsatz, in dem der Polizeimajor Paul Riege schon im Untertitel festhielt, dass es sich um einen „Beitrag für die Erziehung zur Höflichkeit“ handelte. Darin argumentierte er ausgehend von der in Artikel 130 der Weimarer Reichsverfassung enthaltenen Bezeichnung der Beamten als „Diener der Gesamtheit‘: „Aus einem derartigen Verhältnis zwischen Beamtenschaft und Volk geht aber doch nichts so klar hervor, als die Forderung der unbedingten Höflichkeit für alle Beamten ohne Ausnahme. […] Und was für jeden Beamten gilt, gilt doppelt und dreifach für einen Polizeibeamten, der sich wie kein anderer mit allen Schichten der Bevölkerung in ständiger und unmittelbarer Berührung befindet.“1206 In seinen weiteren Ausführungen führte er zunächst die Ursachen für die mangelnde Höflichkeit der Polizeibeamten auf den „deutschen Volkscharakter“ sowie den fehlenden „Konkurrenzkampf“ zurück und versuchte anschließend, aus drei von ihm persönlich erfahrenen Negativbeispielen 1205 Wolter, Das Verhalten des Polizeibeamten im Straßendienst (5.8.1926), S. 397. 1206 Riege, ‚Diener‘ der Gesamtheit (20.9.1926), S. 516. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 347 geeignete Handlungsempfehlungen abzuleiten, um „die Erziehung unserer Beamtenschaft zur Höflichkeit praktisch so zu gestalten, daß sie auch tatsächlich wirksam ist“.1207 Auf eine weitere, eingehendere Auseinandersetzung mit diesen Ausführungen kann an dieser Stelle verzichtet werden, weil sich diese inhaltlich kaum von den weiter oben behandelten Beiträgen unterschieden. Interessant ist allerdings die folgende, in diesem Beitrag enthaltene Einschätzung der Beziehungen zwischen der Polizei und der Bevölkerung: „Die alten Tugenden der Beamtenschaft scheinen sich, wenn wir von zahlreichen Entgleisungen in der Zeit kurz nach der Staatsumwälzung und von den Wirkungen der verzweifelten Wirtschaftslage einzelner absehen, durch die Sturm- und Drangperiode der Kriegs-, Nachkriegsund Inflationsjahre glücklich hindurch gerettet zu haben; das Vertrauen des Volkes in seine Beamtenschaft ist nicht erschüttert – und sehr viel höflicher als früher ist der Beamte im allgemeinen auch nicht geworden.“1208 Paul Riege attestierte den deutschen Polizeibeamten in seinem Beitrag zwar mangelnde Höflichkeit und drängte auf eine Behebung dieses Defizits, allerdings beklagte er nicht, dass die Polizei zu wenig Rückhalt in der Bevölkerung hätte. Vielmehr stellte er hier fest, dass die Bevölkerung der Polizei insgesamt weiterhin vertraue. Dies steht in starkem Kontrast zu den Schilderungen in nahezu allen in den ersten ca. sechs Nachkriegsjahren zu diesem Thema in der ZDPol veröffentlichten Beiträgen, die – wie beispielsweise der oben erörterte Beitrag von Ernst Engelbrecht1209 – von einem völlig zerrütteten Verhältnis ausgingen, der teilweise sogar in Feindseligkeit überging. Der Hinweis des Autors auf gewisse „Entgleisungen“ und eine „Sturm- und Drangperiode“ in den ersten Nachkriegsjahren deutete zwar auf eine temporäre Verschlechterung der Beziehungen zwischen Polizei und Bürger hin, allerdings war er offensichtlich der Ansicht, dass diese Probleme im Spätsommer 1926 bereits der Vergangenheit angehörten und man nun von einem vertrauensvollen Verhältnis ausgehen könne. Insofern bestätigte dies Otto Wolters bereits weiter oben erörterte, ca. einen Mo- 1207 Riege, ‚Diener‘ der Gesamtheit (20.9.1926), S. 515 f. 1208 Riege, ‚Diener‘ der Gesamtheit (20.9.1926), S. 516. 1209 Vgl. Engelbrecht, Polizei und Publikum (5.1.1924), S. 321 f. IV. Die deutsche Polizei in der Zwischenkriegszeit 348 nat ältere Einschätzung, dass die gesellschaftliche Akzeptanz der Polizei bei ihrer alltäglichen Arbeit „bedeutend besser geworden“1210 sei. Etwa ein Jahr später, im Juni 1927, erschien ein weiterer Beitrag in der ZDPol, der sich mit gewissen Einschränkungen ebenfalls der Imageoffensive im Streifendienst zurechnen lassen kann. Unter dem Titel „Der moderne Polizeibeamte des uniformierten Straßendienstes“ setzte sich der Polizeioberst und Kommandeur der badischen Schutzpolizei Erich Blankenhorn mit den besonderen Anforderungen des Streifendienstes auseinander und hielt dabei fest: „Ohne viel Aufsehen zu machen, in taktvoller Zurückhaltung, versieht der Polizeibeamte seinen alltäglichen Straßendienst. Er weiß, daß er der vom Staat berufene Helfer für alle, ohne persönliches Vorurteil irgendwelcher Art, ist. Es ist sicherlich nicht leicht, Hilfsbereitschaft, Takt, Selbstbeherrschung und sorgfältige Überlegung in der Wahl so vieler Mittel unausgesetzt bei der beruflichen Tätigkeit voranzustellen. Dennoch muß es geschafft werden. […] Mit offenen Augen durchwandert der Beamte die Straße, ständig vorbeugend und prüfend. Bereitwillig erteilt er kurz, höflich und bestimmt Auskünfte; betreut er Hilfsbedürftige. […] Die Tätigkeit des Beamten läßt sich vergleichen mit der eines Vaters in der Familie: Staat, vertreten durch den Beamten des uniformierten Dienstes, gleich Vater, Volk gleich Familie.“1211 Erich Blankenhorn forderte von den im Streifendienst tätigen Beamten im Alltag zwar grundsätzlich Hilfsbereitschaft und ein höfliches Auftreten gegenüber dem Bürger ein, allerdings tat er dies weniger plakativ als die weiter oben behandelten Autoren, so dass insgesamt der Eindruck entsteht, dass es eher um Freundlichkeit, aber auch um Bestimmtheit und Neutralität gehe. Davon zeugte nicht zuletzt der sich im letzten Satz der oben zitierte Passage widerspiegelnde Paternalismus, der von einer vormundschaftlichen und damit tendenziell eher autoritären Beziehung zwischen Polizei und Bürger ausging und somit die Forderung nach Höflichkeit und Zurückhaltung sicherlich etwas relativierte. Im weiteren Verlauf des Textes wurde der Autor noch deutlicher, als er explizit anmerkte: 1210 Wolter, Das Verhalten des Polizeibeamten im Straßendienst (5.8.1926), S. 397. 1211 E. Blankenhorn, Der moderne Polizeibeamte des uniformierten Straßendienstes, in: ZDPol, 24. Jg. (1927), Nr. 12 (20.6.1927), S. 281 f. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 349 „Treten außergewöhnliche Fälle ein, so gehört zunächst der an den Platz, der alltäglich da ist, der geschätzt und geachtet ist, der aber auch gefürchtet sein muß, wenn er die Hand zur Strafe erhebt.“1212 Gerade diese Passage verdeutlichte, dass Erich Blankenhorn sich zwar der Notwendigkeit einer guten, vertrauensvollen Beziehung zwischen Polizei und Bürger bewusst war und daher von seinen Beamten ein entsprechend bürgerfreundliches Verhalten einforderte, zugleich aber die praktischen Schwierigkeiten bei der Umsetzung solcher Forderungen im polizeilichen Alltag kannte und daher auch die erforderliche Durchsetzungsstärke der Streifenbeamten hervorhob. Die Polizei war – und ist auch heute noch – nicht nur ‚Freund und Helfer‘, sondern manchmal eben auch die Institution, die gegenüber dem Bürger Zwang ausüben und dessen Fehlverhalten bestrafen musste. Insofern kann man diesen Beitrag zwar durchaus noch der Imageoffensive des Streifendienstes zuordnen – allerdings auf der Grundlage einer realistischeren Vorstellung der praktischen Herausforderungen im alltäglichen Umgang mit dem Bürger. In Bezug auf den Rückhalt, den die Polizei im Alltag des Jahres 1927 in der Bevölkerung genoss, machte Erich Blankenhorn keine eindeutigen Aussagen. Direkt zu Beginn des Beitrags stellte er aber fest: „Die Gestaltung der modernen Polizei im Straßendienst hat in Deutschland viel Kopfzerbrechen bereitet, und auch heute noch sind wir nicht am Ende des geistigen Ringens um sie. […] Die Faktoren der Wirklichkeit lassen sich nicht ohne weiteres wegdividieren. […] Diese Faktoren sind zunächst einmal die Menschen selbst, die nach dem Krieg von beruflich und herkömmlich verschiedenster Art zusammengeströmt sind, die neue Polizei zu bilden, und die vielfach, und das sei hier nicht verschwiegen, alles andere waren als auf den modernen polizeilichen Beruf eingestellte Persönlichkeiten. Dazu kommt die Verschiedenart der Bevölkerung, die sich mehr oder weniger freundlich zur Polizei stellt. Wenige Kilometer können dabei schon starke Gegensätze bedingen. Sodann konnte bei der Not der Nachkriegszeit der Beutel für die Polizei nicht so weit geöffnet werden, wie es im öffentlichen Interesse erwünscht gewesen wäre. Und nicht zuletzt ist es die neue Zeit, in die sich viele noch nicht einordnen können.“1213 1212 Blankenhorn, Der moderne Polizeibeamte des uniformierten Straßendienstes (20.6.1927), S. 282. 1213 Blankenhorn, Der moderne Polizeibeamte des uniformierten Straßendienstes (20.6.1927), S. 281. IV. Die deutsche Polizei in der Zwischenkriegszeit 350 Auch ohne explizite Erwähnung der gesellschaftlichen Akzeptanz der Streifenbeamten dürfte für die Leser dieser Zeitschrift der erste Satz dieser Passage im Kontext der in den Vorjahren zu diesem Thema veröffentlichten Beiträge dennoch so verstanden worden sein, dass das „Kopfzerbrechen“ sich auf die Beziehungen zwischen der Polizei und dem Bürger bezog. Diese waren nach Einschätzung des Autors in den letzten Jahren sehr verbesserungswürdig („viel Kopfzerbrechen“) und mittlerweile auch noch verbesserungsfähig („nicht am Ende des geistigen Ringens“). Zugleich deutete diese Satzkonstruktion auf eine gewisse, vage Verbesserung dieser Beziehungen hin, die mit den oben erörterten Einschätzungen von Otto Wolter und Paul Riege übereinstimmte. Hervorzuheben ist sicherlich seine Feststellung, dass die Schwierigkeiten der Polizei in den letzten Jahren auch auf die Tatsache zurückzuführen sei, dass in den ersten Nachkriegsjahren zahlreiche Polizeibeamte eingestellt worden waren, die für den Polizeidienst eigentlich nicht geeignet waren, was nicht nur korrekt war1214, sondern zudem eine bemerkenswert offene und ehrliche Selbstkritik von Seiten eines Angehörigen des Polizeioffizierskorps darstellte. Des Weiteren wies der Autor knapp auf regionale Unterschiede hinsichtlich der gesellschaftlichen Akzeptanz der Polizei sowie auf nicht näher spezifizierte Schwierigkeiten von Teilen der Bevölkerung, sich an die „neue Zeit“ zu gewöhnen, hin. Weitere Aussagen über den Rückhalt der Polizei in der Bevölkerung machte der Autor nicht, was darauf zurückzuführen sein könnte, dass diese nicht erwähnenswert waren, weil sie relativ ‚normal‘ bzw. unspektakulär waren. Ein weiteres, letztes Beispiel für die Imageoffensive des Streifendienstes in diesen ‚ruhigen‘ Jahren der Weimarer Republik erschien dann im Oktober 1929 in der ZDPol. In diesem Beitrag mit dem Titel „Der Polizeibeamte im Verkehr mit dem Publikum“ stellte der Bremer Polizeihauptwachtmeister Alfred Schulz gleich im ersten Satz fest, dass die Polizei „ihrer Aufgabe nur dann gerecht werden [kann], wenn sie dasjenige Ansehen und Vertrauen genießt, ohne welches die gedeihliche Ausübung einer amtlichen Tätigkeit nicht möglich ist“.1215 Anschließend erläuterte er ausführlich, wie sie dieses Ziel erreichen könne, nämlich indem sie der Bevölkerung gegenüber stets freundlich und zuvorkommend gegenübertrete. Typisch für den Beitrag sind die folgenden Passagen: 1214 Vgl. Schmidt, Schützen und Dienen, S. 68. 1215 A. Schulz, Der Polizeibeamte im Verkehr mit dem Publikum, in: ZDPol, 26. Jg. (1929), Nr. 20 (20.10.1929), S. 514. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 351 „Als Hüter des Gesetzes und der Ordnung hat sich der Polizeibeamte im Verkehr mit dem Publikum stets eines höflichen und vornehmen Tones zu befleißigen. Die Barschheit oder den sogenannten Unteroffizierston muß er sich unter allen Umständen abgewöhnen. […] Grundsatz eines jeden Beamten muß es sein, gerade einem unhöflichen Menschen gegenüber höflich zu sein, denn Höflichkeit ist eine starke Waffe und eine zwingende Macht, der sich selbst ein ungebildeter Mensch nicht entziehen kann. […] Durch herausfordernde Redensarten darf sich der Beamte niemals reizen lassen. Er bewahre vielmehr seine Ruhe und behalte kaltes Blut. Kleine Spötteleien und unpassende Redensarten überhöre er und gehe auf keinen Fall darauf ein. […] Ich verkenne durchaus nicht, daß dieses alles leichter gesagt als getan ist, aber durch Selbstbeherrschung wird er dieses erreichen. […] Ein Polizeibeamter ohne Selbstbeherrschung ist für den Dienst auf der Straße nicht geeignet.“1216 Der Autor forderte von den Streifenbeamten – ähnlich wie die anderen, der Imageoffensive zuzurechnenden Beiträge und wesentlich deutlicher als der zuvor behandelte Beitrag von Erich Blankenhorn – Höflichkeit im Umgang mit der Bevölkerung ein. Um dieses Ziel nicht zu gefährden, sollten auch „kleine“ Beleidigungen oder sonstige Provokationen ignoriert werden. Dabei erkannte der Autor durchaus an, dass dies im alltäglichen Polizeihandeln nicht einfach sei, allerdings müsse ein Streifenbeamter dies dennoch „stets“ umsetzen, da er ansonsten für diesen Dienst ungeeignet sei. Diese doch sehr weitgehenden Forderungen dürften auf weite Teile seiner Leserschaft etwas unrealistisch bzw. naiv gewirkt haben, da Polizeibeamte gerade im Streifendienst zwar nicht permanent, aber doch regelmä- ßig in Situationen gelangten, in denen Durchsetzungsstärke gefragt war und Höflichkeit ein wenig probates Mittel zur Problemlösung darstellte, beispielsweise bei der Schlichtung von ‚Schlägereien‘ oder im Umgang mit alkoholisierten Personen. Im weiteren Verlauf des Beitrags ging Alfred Schulz in knapper Form auf solche Situationen ein, in denen der Polizeibeamte sich gezwungen sehen könnte, „kraftvoll“ und „energisch“ zu handeln, allerdings relativierte er diese Aussage anschließend, indem er hierzu anmerkte: „Hinweisen möchte ich jedoch darauf, daß Energie keineswegs gleichbeutend ist mit Schroffheit und Grobheit. Vielmehr verstehe ich dar- 1216 Schulz, Der Polizeibeamte im Verkehr mit dem Publikum (20.10.1929), S. 514. IV. Die deutsche Polizei in der Zwischenkriegszeit 352 unter ein festes, bestimmtes und ruhiges Auftreten. Ein alter Spruch sagt: ‚Fest in der Tat, mild in der Art.‘ Durch solches Auftreten wird der Beamte sich immer Achtung verschaffen, und die ordnungsliebende Bevölkerung wird ihm dann sicherlich ihre Unterstützung nicht versagen.“1217 Insgesamt stellte dieser Beitrag daher zweifelsohne ein sehr exponiertes Beispiel für die Imageoffensive des Streifendienstes in den ‚ruhigen‘ Jahren der Weimarer Republik dar. Dies zeigte sich nicht zuletzt an der häufigen Verwendung des Begriffs ‚höflich‘ im Text. Wie bei den zuvor besprochenen Beiträgen strebte auch hier der Autor ein zurückhaltendes, höfliches Auftreten der Streifenbeamten an mit dem Ziel, die Akzeptanz der Polizei in der Bevölkerung zu erhöhen. Ob dieses Ziel durch die Imageoffensive tatsächlich erreicht wurde, lässt sich nicht mit Bestimmtheit feststellen. Gleichwohl haben die letzten drei weiter oben behandelten, in den Jahren 1926 und 1927 publizierten Beiträge von Otto Wolter, Paul Riege und Erich Blankenhorn auf eine Verbesserung der Beziehungen zwischen der Polizei und Bürger hingedeutet. Und auch dieser Beitrag von Alfred Schulz aus dem Jahr 1929 deutete in diese Richtung. So enthielten seine Ausführungen keinerlei Hinweis auf einen mangelnden gesellschaftlichen Rückhalt der Polizei. Stattdessen merkte er diesbezüglich an: „Gerade die minderbemittelte und gegenwärtig in Bedrängnis befindliche Bevölkerung kommt vertrauensvoll zu dem Polizeibeamten, um sich Rat und Auskunft zu erbitten. Hier hat er Gelegenheit, durch Worte und Werke zu beweisen, daß es ihm ernst ist, dem Publikum ein Helfer zu sein.“1218 Dass der Autor das Verhältnis von Polizei und Bürger hier nicht nur explizit als „vertrauensvoll“ charakterisierte, sondern dies darüber hinaus auf die unteren Gesellschaftsschichten bezog, mit denen die Polizei gemäß dem konflikttheoretischen Ansatz der Polizeisoziologie traditionell eine eher problematische Beziehung hatte1219, war zweifelsohne bemerkenswert. Noch erstaunlicher wurde diese Einschätzung, wenn man zudem berücksichtigte, dass Alfred Schulz in seinem etwas mehr als fünf Jahre zu- 1217 Schulz, Der Polizeibeamte im Verkehr mit dem Publikum (20.10.1929), S. 515. 1218 Schulz, Der Polizeibeamte im Verkehr mit dem Publikum (20.10.1929), S. 514. 1219 Vgl. Reiner, The Politics of the Police, S. 47ff.; Knöbl, Polizei und Herrschaft, S. 57ff. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 353 vor in der ZDPol veröffentlichten, weiter oben erörterten Beitrag zur Einführung des Gummiknüppels als Ersatz für den Säbel noch festgestellt hatte: „Bei uns dagegen kann man täglich beobachten, daß beim Einschreiten des Beamten auf der Straße das Publikum, das sich ja sogleich in großer Zahl versammelt, ohne auch nur die geringste Ahnung von dem Grunde zu haben, sich auf die Seite des Beschuldigten stellt und Partei gegen den Beamten ergreift.“1220 Dieser starke Kontrast zwischen den ca. fünf Jahre auseinanderliegenden Aussagen ein und desselben Autors verdeutlicht im Zusammenspiel mit den weiter oben behandelten Einschätzungen von Otto Wolter, Paul Riege und Erich Blankenhorn, dass sich die Akzeptanz der Polizei in der Bevölkerung in den ‚ruhigen‘ Jahren der Weimarer Republik zwischen 1924 und 1929 mit hoher Wahrscheinlichkeit verbessert haben dürfte. Das Ausmaß dieser Verbesserung und der genaue Beitrag der Imageoffensive der Streifenpolizei zu diesem Erfolg bleiben zwar unklar, da zweifelsohne auch zahlreiche andere polizeiinterne Faktoren – wie z. B. die weiter oben behandelten Professionalisierungs-, Modernisierungs- und Demokratisierungsprozesse – und polizeiexterne Entwicklungen – wie z. B. die verbesserten makroökonomischen Rahmenbedingungen und der Rückgang der Kriminalität und insbesondere der politischen Gewalt – in diesem Zeitraum eine wesentliche Rolle gespielt haben dürften. Gleichwohl wäre es ziemlich unplausibel anzunehmen, dass die zahlreichen, sowohl von Polizeiwachtmeistern wie von Angehörigen des Polizeioffizierskorps deutlich geäußerten Aufrufe, durch einen freundlichen und höflichen Umgang mit dem Bürger zu einer Erhöhung des Rückhalts der Polizei in der Bevölkerung beizutragen, ohne jede Wirkung blieben. Wesentlich plausibler erscheint hingegen die Annahme, dass in diesen Jahren in Einklang mit Alf Lüdtkes herrschaftssoziologischem Ansatz von staatlicher Herrschaft als sozialer Praxis1221 in der alltäglichen Polizeiarbeit im Rahmen der „eigentümliche[n] ‚Gemengelagen‘“1222 aus mehr oder weniger subtilen Mechanismen, mit denen die Polizei als sichtbarster Repräsentant des Staates ihren Machtanspruch im Alltag durchzusetzen versuchte, den ambivalenten, alltäglichen Reaktionen der Bevölkerung darauf und den sich verbes- 1220 Schulz, Ist die Einführung eines Gummiknüppels zweckmäßig? (20.1.1924), S. 340. 1221 Vgl. Lüdtke, Einleitung: Herrschaft als soziale Praxis, S. 9ff. 1222 Lüdtke, Einleitung: Herrschaft als soziale Praxis, S. 18. IV. Die deutsche Polizei in der Zwischenkriegszeit 354 sernden oder zumindest stabilisierenden ökonomischen, politischen und gesellschaftlichen Rahmenbedingungen tatsächlich eine gewisse Annäherung zwischen Polizei und Bürger stattfand. Das Ausmaß und die Nachhaltigkeit dieser Entwicklung war Ende des Jahres 1929 sicherlich noch nicht abzuschätzen, sollte sich aber in den darauf folgenden, alles andere als ‚ruhigen‘ Jahren herausstellen. Zivilisierungstendenzen bei polizeilichen Großlagen Wie weiter oben bei der Darstellung der historischen Grundlagen der Zwischenkriegszeit aufgezeigt wurde, kann man in Bezug auf die Periode zwischen 1924 und 1929 in sicherheitspolitischer Hinsicht insofern tatsächlich von ‚ruhigen Jahren‘ sprechen, als sie sich durch einen spürbaren Rückgang der politischen Gewalt auszeichnete. Dieser Rückgang fiel gerade hinsichtlich der Häufigkeit von größeren, gewaltsamen Unruhen, Aufständen oder Putschversuchen im Vergleich zu den turbulenten Anfangsjahren der Weimarer Republik sehr deutlich aus.1223 Dementsprechend spielte die Bewältigung von polizeilichen Großlagen in dieser Zeit eine deutliche geringere Rolle im praktischen Arbeitsalltag der deutschen Polizei. Insofern verwundert es nicht, dass dieses Themenfeld in der ZDPol ab dem Jahr 1924 weniger intensiv behandelt wurde als in den Jahren zuvor. Gleichwohl erschienen weiterhin regelmäßig Beiträge, die sich mit dieser Thematik – meistens ohne einen speziellen Anlass in Form von konkreten, größeren Unruhen oder Aufständen – beschäftigten. Ein typisches Beispiel für diese Form der Beiträge war der im September 1924 in der ZDPol publizierte Aufsatz des promovierten Dresdner Polizeiobersts Hermann Schützinger mit dem Titel „Neue Kampfformen der KPD“.1224 Der Autor, der bereits neun Monate zuvor einen Beitrag in dieser Zeitschrift veröffentlicht hatte und darin – wie weiter oben gezeigt – durchaus ausgewogene, liberale Ansichten zur Entwicklung der Schutzpolizei geäußert hatte1225, behandelte in diesem Beitrag einige neuere Erkenntnisse bezüglich der taktischen Vorgehensweise der KPD bei gewalth) 1223 Vgl. Schumann, Politische Gewalt, S. 203 und S. 228; Mai, Die Weimarer Republik, S. 54; Niedhart, Deutsche Geschichte, S. 114; Kolb, Deutschland, S. 109. 1224 Vgl. H. Schützinger, Neue Kampfformen der KPD, in: ZDPol, 21. Jg. (1924/25), Nr. 11 (5.9.1924), S. 266ff. 1225 Vgl. Schützinger, Neue Wege der Schutzpolizei (5.1.1924), S. 307ff. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 355 samen Auseinandersetzungen mit der Polizei, die auf gerichtlichen und polizeilichen Ermittlungen gegen Mitglieder dieser Partei beruhten. Dabei zitierte er zu Beginn seines Beitrags eine längere Passage aus einem dabei zutage geförderten Dokument mit dem Titel „Anweisung für die Partei- Funktionäre in Ost- und Südwestdeutschland“, die sehr detailliert beschrieb, wie die KPD bei Demonstrationen und Straßenkämpfen möglichst effektiv gegen die Polizei vorgehen sollte. Die zentrale taktische Vorgabe bestand darin, bei Massendemonstrationen mit Pistolen und Handgranaten bewaffnete KPD-Kämpfer unter die unbewaffneten Demonstranten zu mischen, um die Polizei dann bei günstiger Gelegenheit anzugreifen. Zwar sollten die Polizeibeamten dabei möglichst nur entwaffnet werden, allerdings mit Ausnahmen: „Bei entschlossenem Zugreifen wird es dann fast immer möglich sein, Entwaffnungsaktionen unter Vorhalten von Pistolen durchzuführen. Offiziere und besondere brutale Polizeibeamte, die zum Vorgehen gegen die Demonstranten auffordern, sind sofort unschädlich zu machen.“1226 Gerade diese im letzten Satz enthaltene, recht unverhohlene Aufforderung zum Polizistenmord dürfte ihre Wirkung bei der aus Polizeibeamten und -offizieren bestehenden Leserschaft dieses Aufsatzes nicht verfehlt haben. Vor dem Hintergrund solcher Aussagen erscheint Dirk Schumanns Einschätzung, dass die deutsche Polizei im Jahr 1924 „in den Kommunisten weiterhin ihren Hauptgegner sah“1227, durchaus plausibel und gerechtfertigt. Die Bedeutung des zitierten Dokuments fasste Hermann Schützinger dann folgendermaßen zusammen: „Der Grundgedanke dieser Anweisung ist der, durch Kombination von Massendemonstrationen und bewaffneten Stoßtrupps die Schutzpolizei entwaffnen und außer Gefecht setzen zu können. Der Plan enthält zweifellos ernste Gefahrenmomente gegenüber einer überraschten und ununterrichteten Polizei; die blindwütige, wenn auch unbewaffnete Masse bedeutet nun einmal für sie eine viel größere Gefahr als ein in lockeren Angriffswellen vorgehender, bewaffneter Gegner. Der Gedanke, unter dem Schutz waffenloser Männer, Frauen und Kinder bewaffnete Stoßtrupps zum Handstreich anzusetzen ist also – so brutal 1226 Schützinger, Neue Kampfformen der KPD (5.9.1924), S. 266. 1227 Schumann, Politische Gewalt, S. 228. IV. Die deutsche Polizei in der Zwischenkriegszeit 356 und niederträchtig er vom menschlichen Gesichtspunkt aus erscheint – polizeitaktisch vollkommen richtig und sehr ernst zu nehmen.“1228 Die Ausführungen des Autors verdeutlichten, dass von der KPD im Herbst des Jahres 1924 zweifellos eine ernstzunehmende Gefährdung der staatlichen Sicherheit und Ordnung ausging und dass zumindest ein Teil ihrer Anhänger bereit war, mit potenziell tödlicher Gewalt gegen die Polizei vorzugehen. Insofern musste sich die Polizei, wie auch schon in den Jahren zuvor, mit der Frage auseinandersetzen, wie sie diese Gefahr effektiv bekämpfen sollte. Interessant war an diesem Beitrag nun aber die Art und Weise, wie der Autor seine Ansichten und Empfehlungen zu diesem Themenfeld in seinem Beitrag äußerte, die sich deutlich von in den Vorjahren in dieser Zeitschrift publizierten, martialisch anmutenden, eine manipulative Sprache verwendenden Beiträgen1229 unterschied. So verwendete Hermann Schützinger im hier betrachte Aufsatz weitgehend neutral-sachlich gehaltene sprachliche Formulierungen, die eine Emotionalisierung vermieden, beispielsweise indem er die KPD-Kämpfer als „bewaffnete Stoßtrupps“ bezeichnete – und nicht wie in einem 1921 erschienenen, weiter oben bereits erörterten Beitrag als „Banden, die sich abseits der Hauptstraßen plündernd, brandschatzend und mordend auf dem flachen Lande umhertrieben“ bzw. „sich umhertreibende[n] Banden, die der Schrecken der Bevölkerung geworden waren.“1230 Die kommunistischen Angriffstaktiken bezeichnete er in der oben zitierten Passage zwar zunächst als „brutal und niederträchtig“, allerdings schob er unmittelbar hinterher, dass sie „polizeitaktisch vollkommen richtig“ seien. Darüber hinaus waren auch seine polizeitaktischen Ausführungen offensichtlich von dem Gedanken getragen, eine möglichst gewaltfreie, deeskalative Konfliktlösung zu erreichen. So empfahl er beispielsweise, stets mindestens „30 m Abstand“ von den Demonstranten zu halten, im Notfall „Salvenfeuer über die Köpfe hinweg“ abzugeben oder „in ‚Doppelkolonne‘ an[zu]rücken und im Marsch sich an eine Häuserreihe an[zu]lehnen“.1231 Besonders deutlich wurde die dahinterliegende Intention des Autors im letzten Absatz dieses Beitrags, als er anmerkte: 1228 Schützinger, Neue Kampfformen der KPD (5.9.1924), S. 266. 1229 Vgl. insb. o. V., Darstellung der Bekämpfung des Aufruhrs (20.4.1921), S. 31ff.; o. V., Erfahrungen und Bemerkungen aus der Bekämpfung des Aufruhrs (5.5.1921), S. 60ff. 1230 o. V., Darstellung der Bekämpfung des Aufruhrs (20.4.1921), S. 32 und S. 35. 1231 Schützinger, Neue Kampfformen der KPD (5.9.1924), S. 267. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 357 „Trotz aller polizeitechnischen und taktischen Abwehrmaßnahmen gegen die neuen Kampfformen der KPD sind die politischen und massenpsychologischen Gesichtspunkte des Pol.-Einsatzes nicht außer acht zu lassen. Gelingt es, durch enge Fühlungnahme mit dem demokratischen Teil der Arbeiterschaft, durch den sachgemäßen Gebrauch staatserhaltender Ordner-Verbände die Trennung zwischen den republikanischen und den putschistischen Massen des schaffenden Volkes effektiv zu gestalten, dann ist der staatspolitische Polizeizweck endgültig erreicht und gesichert.“1232 Hermann Schützinger machte seiner Leserschaft hier klar, dass es sich bei einer kommunistischen Demonstration nicht um einen militärischen Konflikt handelte, bei dem die Polizei einen Feind mit militärischen Mitteln zu besiegen hatte, sondern prinzipiell um eine in einer Demokratie zulässige Form der Meinungsäußerung. Lediglich der ‚putschistische‘ Teil der Demonstranten sei daher mit polizeilichen Mitteln zu bekämpfen, während der ‚demokratische‘ bzw. ‚republikanische‘ Teil der Arbeiterschaft vielmehr unter dem Schutz der Polizei zu stehen habe. Einer an militärischen Kriterien orientierten Zielsetzung setzte er den ‚staatspolitischen Polizeizweck‘ gegenüber, den er zwar nicht genauer erläuterte, der sich aber offensichtlich an der demokratischen Grundordnung der Weimarer Republik orientieren sollte. Um dies zu erreichen, war er sogar grundsätzlich bereit, die Rolle der Polizei der der Bewältigung von solchen polizeilichen Großlagen zu beschränken zu Gunsten von ‚staatserhaltenden Ordner-Verbänden‘, womit er vermutlich das SPD-nahe ‚Reichsbanner Schwarz-Rot-Gold‘ meinte, das Anfang des Jahres 1924 gegründet worden war.1233 Insofern deuteten Hermann Schützingers Ausführungen darauf hin, dass die bereits weiter oben ausführlich erläuterten Bemühungen der politischen Führung zur Demokratisierung der deutschen Polizei ‚von oben‘ in diesen Jahren auch auf die Bewältigung von polizeilichen Großlagen ausstrahlte. Dass dies nicht nur die Einzelmeinung eines ohnehin liberalen, der republikanischen Staatsordnung positiv gegenüberstehenden Polizeioffiziers war, sondern durchaus auch von anderen Polizeiführern so gesehen wurde, zeigte ein weiterer Beitrag zu diesem Thema, der ein Jahr später, d. h. im September 1925, in der ZDPol publiziert wurde. Dieser beruhte auf einem Vortrag zum Einsatz von geschlossenen Abteilungen zur Bewältigung von polizeilichen Großlagen, den der Polizeioberst Oldenburg auf der 1. Preu- 1232 Schützinger, Neue Kampfformen der KPD (5.9.1924), S. 268. 1233 Vgl. Schumann, Politische Gewalt, S. 210ff. IV. Die deutsche Polizei in der Zwischenkriegszeit 358 ßischen Polizeiwochen in Frankfurt a. M. gehalten hatte, was darauf hindeutete, dass den darin geäußerten Ansichten eine gewisse Repräsentativität bezüglich der preußischen Polizei zukommen dürfte.1234 Auch hier stellte der Autor unmissverständlich fest: „Klar ist, daß der polizeiliche Kampf nach militärischen Grundsätzen nicht geführt werden kann, da er von ganz anderen Bedingungen und Voraussetzungen ausgeht. Der Kampf einer militärischen Truppe […] ist eingestellt auf Vernichtung […]. Der Soldat […] wird mehr erzogen für die Verwendung und den Gehorsam in der Masse. Der einzelne Polizist muß in ganz besonderem Maße zu selbständigem und selbsttätigem Denken und Handeln, zum Verantwortungsgefühl und zu großer Verantwortungsfreudigkeit erzogen werden. Der Kampf, den die Schutzpolizei als notwendiges Übel führen muß, wird nicht geführt gegen einen Feind, sondern er wird geführt gegen Volksgenossen. Das Endziel dieses Kampfes ist nicht Vernichtung, sondern die Festnahme der unbotmäßigen Volksgenossen.“1235 Wie schon Hermann Schützinger zuvor distanzierte sich auch Oldenburg von jeglicher militärischen Orientierung und hob stattdessen die Notwendigkeit hervor, das polizeiliche Gegenüber bei Großlagen als aufsässigen Mitbürger bzw. ‚Volksgenossen‘ zu sehen, den es gemäß der in einem demokratischen Staatswesen geltenden Spielregeln nicht zu vernichten, sondern festzunehmen galt. Darüber hinaus stellte er dem Gehorsam des Soldaten die Selbständigkeit und die große Verantwortung des Polizeibeamten im Umgang mit solchen Situationen gegenüber und betonte so auch die interne, das Verhältnis zwischen Vorgesetzten und Untergebenen betreffende Dimension der Demokratisierung der Polizei. Die sich darin widerspiegelnde Gesinnung zeigte sich auch in seinen weiteren Ausführungen, in denen er bei polizeilichen Großlagen von den zuständigen Polizeiführern in Einklang mit der oben behandelten Imageoffensive des Streifendienstes „höfliches, ruhiges und sachliches Verhalten“ sowie „ein humorvolles Wort am rechten Ort“1236 einforderte, um sich anbahnende, gewaltsame Konflikte zu entschärfen. Zudem setzte Oldenburg sich nicht nur mehrmals sehr deutlich für einen äußerst restriktiven Waffengebrauch ein, der erst dann in Frage komme, „wenn alle polizeilichen Mittel restlos 1234 Vgl. Oldenburg, (Vorname fehlt), Die polizeiliche Verwendung, in: ZDPol, 22. Jg. (1925), Nr. 12 (20.9.1925), S. 323ff. 1235 Oldenburg, Die polizeiliche Verwendung (20.9.1925), S. 323. 1236 Oldenburg, Die polizeiliche Verwendung (20.9.1925), S. 324. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 359 erschöpft sind“1237, sondern wies sogar darauf hin, dass bereits das demonstrative Zeigen von schwerer Bewaffnung „eine unerwünschte Aufreizung der Massen“1238 bewirken könnte. Schließlich bewies er eine äußerst positive Einstellung gegenüber der Meinungs- und Versammlungsfreiheit, indem er nicht nur mehrmals darauf hinwies, dass Demonstrationen zulässig und von der Polizei zu schützen seien, sondern ebenfalls mehrmals die davon ausgehende konfliktentschärfende Wirkung betonte: „Er kann auch die Erregung, die sich der Masse bemächtigt hat, verpuffen lassen dadurch, daß er die Versammlungsteilnehmer in Zügen in die Straßen hineinleitet. Wenn die Menge in die Lage versetzt wird, ihrer Meinung und Willensäußerung in irgendeiner Form Ausdruck zu verleihen, so wird die Erregung, die sich in der Masse angesammelt hat, abebben, sobald man ihr Ausdrucks- und Ablenkungsmöglichkeiten verschafft. […] Wir haben hier in Frankfurt bei verschiedenen Anlässen sich ruhig Gegendemonstrationszüge bilden lassen und sie nicht verboten aus dem einfachen Grunde, weil es zweckmäßiger erschien, auch diesen Leuten die Gelegenheit zu Ausdrucksmöglichkeiten zu geben und sie abzulenken. Die Polizei hatte nur die Pflicht, dafür zu sorgen, daß die Teilnehmer der verschiedenen Züge nicht aneinandergerieten.“1239 Dementsprechend warnte Oldenburg seine Leserschaft auch davor, die durchaus vorhandenen gesetzlichen Möglichkeiten, Demonstrationen und sonstige Umzüge zu verbieten, exzessiv zu nutzen, weil dies möglicherweise kontraproduktiv sei. Insgesamt verdeutlichte dieser Beitrag, ebenso wie der zuvor behandelte Beitrag von Hermann Schützinger, dass die weiter oben bereits ausführlich in Bezug auf die institutionelle Entwicklung der Polizei dargestellten, von der politischen Führung vorangetriebenen Demokratisierungsprozesse auch auf die als besonders militärisch geprägt geltenden, geschlossenen Verbände der Schutzpolizei und die Bewältigung von polizeilichen Großlagen als ihren Hauptaufgabenbereich ausstrahlten. Vergleicht man die von den beiden Autoren deutlich ausgedrückte Distanzierung von militärischen Einsatztaktiken, ihre Befürwortung der verfassungsmäßigen Meinungs- und Versammlungsfreiheit und ihre sachlich-rational gehaltenen Plädoyers für ein möglichst zurückhaltendes und gewaltloses Vorgehen der Polizei bei der Bewältigung von polizeilichen Großla- 1237 Oldenburg, Die polizeiliche Verwendung (20.9.1925), S. 324. 1238 Oldenburg, Die polizeiliche Verwendung (20.9.1925), S. 325. 1239 Oldenburg, Die polizeiliche Verwendung (20.9.1925), S. 324 und S. 326. IV. Die deutsche Polizei in der Zwischenkriegszeit 360 gen mit entsprechenden Ausführungen in Beiträgen, die zu Beginn der 1920er Jahre in der ZDPol veröffentlicht wurden, dann entsteht der Eindruck, dass zu Beginn der ‚ruhigen‘ Jahre der Weimarer Republik eine gewisse Zivilisierung1240 dieses polizeilichen Aufgabenbereichs stattfand. Dieser Zivilisierungsprozess war allerdings in der Polizei von Anfang an nicht unumstritten und stieß teilweise auf Widerstand oder zumindest Ambivalenz. So erschien beispielsweise ab Oktober 1925 in der ZDPol in drei Teilen ein sehr ausführlicher Beitrag des Polizeimajors Ferdinand Kronberger mit dem Titel „Polizeitaktische Betrachtungen“ zu diesem Thema.1241 In diesem Aufsatz distanzierte sich der Autor zu Beginn zunächst von einem an militärischen Grundsätzen orientierten Vorgehen der Polizei im Rahmen von polizeilichen Großlagen: „Das Bestreben der Polizei muß darauf gerichtet sein, die Aufgaben, den Staatswillen durchzusetzen und die Ruhe und Ordnung wiederherzustellen, unblutig zu lösen. Der Gebrauch der Schußwaffe im Innern macht böses Blut, schafft Erbitterung und schädigt den Ruf der Polizei; er ist in der Wirkung zu scharf und kann die schlimmsten Folgen haben. Unbeteiligte, Frauen und Kinder werden getroffen, die Beamten verlieren in der Hitze des Gefechts die kalte Berechnung, das läßt sich gar nicht vermeiden. […] Die Polizei steht dem Publikum sachlich und neutral gegenüber, keineswegs feindselig, handelt es sich doch letzten Endes um unsere Stammesbrüder, gegen die wir gezwungen sind, einzuschreiten. Es kommt für uns lediglich darauf an, die Widerspenstigen zum Gehorsam zu zwingen, es kann aber nicht in unserer Absicht liegen, die Leute ernstlich zu schädigen und sie ihr Leben lang unglücklich zu machen.“1242 Ferdinand Kronenberger wiederholte hier zunächst den bereits in den beiden zuvor behandelten Beiträgen von Hermann Schützinger und Oldenburg festgestellten Kerngedanken, dass die das polizeiliche Gegen- über auch bei Großlagen nicht als Feind, sondern als fehlgeleiteter, widerspenstiger „Stammesbruder“ bzw. ‚Volksgenosse‘ gesehen werden sollte, so dass entsprechende Einsätze möglichst ohne Waffengewalt zu bewältigen 1240 Zum Zivilisierungsbegriff bzw. -ansatz vgl. Elias, Über den Prozeß der Zivilisation. 1241 Vgl. F. Kronberger, Polizeitaktische Betrachtungen, in: ZDPol, 22. Jg. (1925), Nr. 13 (5.10.1925), S. 355ff., Nr. 14 (20.10.1925), S. 388ff., Nr. 15 (5.11.1925), S. 419 f. 1242 Kronberger, Polizeitaktische Betrachtungen (5.10.1925), S. 355. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 361 seien. Dementsprechend hätten die Leser dieses Beitrags nach dem Lesen der ersten Absätze davon ausgehen können, dass der Autor auf den nun folgenden Seiten erläutern würde, wie dieses Ziel erreicht werden könnte. Die dann folgenden Ausführungen zeichneten allerdings ein gänzlich anderes Bild. In diesen bewies der Autor sowohl auf der sprachlichen wie der inhaltlichen Ebene, dass er bezüglich der Bewältigung von polizeilichen Großlagen offensichtlich weiterhin in militärischen Kategorien dachte, die mit dem oben angedeuteten Zivilisierungsprozess kaum in Einklang zu bringen waren. Sein Verständnis von Zivilisierung spiegelte sich beispielsweise in seiner Forderung wider, bei der Zerschlagung von Demonstrationen oder sonstigen Kundgebungen anstelle von Schusswaffen „ungiftiges Gas“ zu verwenden, dessen Folgewirkungen „in 1-2 Tagen wieder behoben“ waren und das „wegen seiner Ungefährlichkeit auch gegen Frauen und Kinder, die sich aus Neugierde unter der Menge befinden, benützt werden“1243 konnte. Konnte diese Forderung von seiner Leserschaft möglicherweise noch als unglückliche sprachliche Formulierung des Autors eingeordnet werden, so war seine militärische Prägung bei seinen Ausführungen zum Umgang mit bewaffneten Aufständischen nicht zu übersehen. So strafte er seine oben zitierten Aussagen, dass die Polizei dem polizeilichen Gegenüber bei Großlagen „keineswegs feindselig“ gegenübertreten sollte, Lügen, indem er sie in seinem Beitrag durchgängig mit Bezeichnungen wie „Feind“1244, „feindliche Postenlinie“ oder „feindliche Schützen“1245 belegte. Und auch seine obigen Forderungen, solche Konflikte „unblutig zu lösen“ und davon abzusehen, „die Leute ernstlich zu schädigen“, wirkten angesichts von Passagen wie der folgenden wenig glaubwürdig: „Wenn dagegen der Feuerkampf aufgenommen wird, dann ist er auch bis zur Entscheidung durchzuführen. Ein vorzeitiges Abbrechen des Gefechts sieht wie ein Rückzug aus, schadet dem Ansehen der Polizei und hebt den Mut des Gegners. […] Die Polizei muß sich daran gewöhnen, im Kampf an Zahl unterlegen zu sein. In der Front ist der Sonderwagen – 1 Maschinengewehr ist noch verwendungsfähig – mit einigen Begleitern einzusetzen, alles andere dazu zu verwenden, die gegnerische Stellung von der Seite her auszurollen.“1246 1243 Kronberger, Polizeitaktische Betrachtungen (5.10.1925), S. 355. 1244 Kronberger, Polizeitaktische Betrachtungen (5.10.1925), S. 357. 1245 Kronberger, Polizeitaktische Betrachtungen (5.10.1925), S. 356. 1246 Kronberger, Polizeitaktische Betrachtungen (5.10.1925), S. 356. IV. Die deutsche Polizei in der Zwischenkriegszeit 362 Noch deutlicher war schließlich die folgende Aussage Ferdinand Kronbergers, die so prägnant formuliert war und die militärische Orientierung des Autors so schonungslos und unmissverständlich aufdeckte, dass sie auch von Christian Knatz in einem Beitrag1247 wörtlich wiedergegeben wird: „Es handelt sich bei der Polizei nicht darum, den Gegner zu werfen und einen Sieg im landläufigen Sinne davonzutragen, denn das führt immer wieder zu neuen Schlachten, sondern das Endziel soll sein die Vernichtung des Gegners, dazu müssen wir ihn umfassen, einschlie- ßen, endgültig erledigen und Menschen, Waffen und Material in die Hand bekommen.“1248 Dass es sich hierbei um eine Aufforderung zur Tötung des ‚Feindes‘ handelte, dürfte der im Wesentlichen aus Polizeibeamten bestehenden Leserschaft dieses Beitrags nicht entgangen sein. Daran, dass es sich bei den zu bekämpfenden oder gar zu tötenden ‚Feinden‘ um Kommunisten handelte, ließ der Autor ebenfalls keine Zweifel, da er bei seinen ausführlichen Schilderungen der von der Polizei bei Großlagen zu ergreifenden Einsatztaktiken ausschließlich auf Beispiele aus der Vergangenheit verwies, in denen die Polizei kommunistische Aufstände bekämpft hatte, insbesondere den Mitteldeutschen Aufstand von 1921 und die Hamburger Unruhen von 1923, und die Gegner auch ausdrücklich so bezeichnete: „Die Kommunisten legen besonderen Wert darauf, mit kleinen bewaffneten Gruppen herumzustreifen und überraschend aufzutreten, um den Gegner fortgesetzt zu beunruhigen. Der kämpfende Arbeiter muß überall und nirgends sein, nie zu fassen sein, unvermutet erscheinen, rasch wieder verschwinden. ‚Feind überall‘ soll das Kennzeichen der Lage sein.“1249 Bemerkenswert erscheint hier, dass Ferdinand Kronberger hier nicht nur ausdrücklich die „Kommunisten“ als klassisches Feindbild der Weimarer Polizei1250 ansprach, sondern sogar so weit ging, die die Gegner der Polizei als „kämpfende Arbeiter“ zu bezeichnen. Dies deutete auf ein gewisses Misstrauen des Autors in Bezug auf die gesamte Arbeiterklasse hin, das in der weiter oben schon mehrmals angesprochenen, ‚reaktionären‘ Strö- 1247 Vgl. Knatz, Polizei in der Weimarer Republik, S. 51. 1248 Kronberger, Polizeitaktische Betrachtungen (20.10.1925), S. 390. 1249 Kronberger, Polizeitaktische Betrachtungen (5.10.1925), S. 357. 1250 Vgl. Knatz, Polizei in der Weimarer Republik, S. 51; Schmidt, Schützen und Dienen, S. 74 f. und S. 252 f. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 363 mung der Weimarer Polizei und insbesondere im konservativ-monarchistisch orientierten Polizeioffizierskorps sicherlich keine Seltenheit war1251 und das dem Grundgedanken des konflikttheoretischen Ansatzes der Polizeisoziologie entsprach, demzufolge die Polizei kein neutrales Instrument staatlicher Herrschaft, sondern vielmehr ein Mittel der herrschenden Klassen zur Erhaltung ihrer Macht und zur Unterdrückung der Arbeiterklasse bzw. der unteren Gesellschaftsschichten sei.1252 Anders als in den zuvor besprochenen Beiträgen von Hermann Schützinger und Oldenburg, die bei der Charakterisierung von Aufständischen eine nüchtern-rationale Sprache verwendet und auf eine negative Emotionalisierung verzichtet hatten, scheute Ferdinand Kronberger auch nicht davor zurück, mit Passagen wie der folgenden das ohnehin bestehende polizeiliche Feindbild des Kommunisten weiter zu vertiefen: „Wir machten die Erfahrung, daß den Aufständischen der Begriff der Waffenehre fehlt, sie brechen den Vertrag und scheuen sich nicht, die wehrlos gewordenen Gefangenen zu ermorden. Selbst wenn den Beamten freier Abzug zugesichert wird, kann nicht dringend genug davor gewarnt werden, den Aufrührern zu trauen und die Waffen auszuliefern, denn es bedeutet fast immer die eigene Vernichtung.“1253 Nicht nur, dass es keinerlei Belege dafür gab, dass diese „Erfahrung“ der Wahrheit entsprach, hinzu kam noch die eindeutig auf eine Herabwürdigung und Beleidigung der Aufständischen abzielende Charakterisierung als ehrlose, nicht vertrauenswürdige Mörder, die wehrlose, in Gefangenschaft geratene Polizeibeamte „fast immer“ töteten. Gerade der direkte Vergleich solcher Passagen mit der zu Beginn des Beitrags noch geäußerten Auffassung, dass das die Polizei „dem Publikum sachlich und neutral gegenüber[stehe]“, weil es sich ja um „Stammesbrüder“1254 handele, verdeutlichte die enormen Widersprüche, in die sich der Autor verstrickte. Insgesamt muss daher wohl davon ausgegangen werden, dass die auf eine Zivilisierung hindeutenden Aussagen Ferdinand Kronbergers zu Beginn des Beitrags nicht wirklich ehrlich gemeint waren, sondern ein oberflächliches und unglaubwürdiges Zugeständnis an die entsprechenden politischen Vorgaben der Reichsregierung und insbesondere des SPD-geführten preu- 1251 Vgl. Leßmann-Faust, Die Preußische Schutzpolizei, S. 153ff. 1252 Vgl. Reiner, The Politics of the Police, S. 40; Storch, Engels, The plague of blue locusts, S. 61ff. 1253 Kronberger, Polizeitaktische Betrachtungen (5.10.1925), S. 357. 1254 Kronberger, Polizeitaktische Betrachtungen (5.10.1925), S. 355. IV. Die deutsche Polizei in der Zwischenkriegszeit 364 ßischen Innenministeriums darstellten. Vielmehr deutet der Beitrag darauf hin, dass der Autor – und mit ihm vermutlich ein erheblicher Teil der Polizei und insbesondere des Polizeioffizierskorps – im Oktober 1925 alles andere als eine Zivilisierung der polizeilichen Bekämpfung von Großlagen anstrebte und weiterhin Einsatztaktiken, die sich an militärischen Grundsätzen orientierten, für angemessener hielt. Dass dies zum einen keine Einzelmeinung war und sie zum anderen auch in den folgenden Jahren unter dem Polizeioffizieren verbreitet blieb, zeigte ein zwei Jahre später, im November 1927, in der ZDPol veröffentlichter Beitrag.1255 Diese – wie Ferdinand Kronbergers eben behandelter Aufsatz – ebenfalls sehr ausführliche, in drei Teilen erschienene Abhandlung des Darmstädter Polizeioberstleutnants Karl Schröder mit dem Titel „Straßen- und Häuserkampf“ musste auf den regelmäßigen Leser dieser Zeitschrift fast wie eine Kopie desselben erscheinen, da der argumentative Aufbau, aber auch der allgemeine sprachliche Duktus sehr ähnlich waren. Wie zuvor Ferdinand Kronberger so vertrat auch Karl Schröder zu Beginn seines Beitrags noch Ansichten, die auf eine Distanzierung von militärischen Grundsätzen und eine Zivilisierung der Bewältigung von polizeilichen Großlagen hindeuteten: „Eins ist voranzustellen: daß der Polizeikampf sich von einem militärischen Kampf gleicher Art himmelweit unterscheidet. […] Vor allem ergibt sich hier wie auch bei sonstigen Polizeiaktionen der Unterschied aus dem verschiedenen Endzweck der Aktion. Beim Militär rücksichtsloses Bekämpfen des Feindes bis zu dessen Vernichtung, bei der Polizei lediglich Wiederherstellung der staatlichen Ordnung unter möglichstem Vermeiden jedes unnötigen Blutvergießens, Einschreiten gegen irregeleitete Volksgenossen, deren Vernichtung niemals Endziel der Kampfhandlungen sein kann, ferner Rücksichtnahme auf die unbeteiligte Bevölkerung und deren Eigentum.“1256 Frappierend waren dabei die inhaltlichen Parallelen zwischen diesen beiden Beiträgen, die teilweise sogar in wortidentischen Formulierungen mündeten. Noch frappierender war allerdings die Tatsache, dass Karl Schröder sich dann analog zu Ferdinand Kronberger in seinen weiteren Ausführungen in einer Weise zu diesem Thema äußerte, der keinen Zwei- 1255 Vgl. K. Schröder, Straßen- und Häuserkampf, in: ZDPol, 24. Jg. (1927), Nr. 20 (20.10.1927), S. 489ff., Nr. 21 (5.11.1927), S. 518ff., Nr. 22 (20.11.1927), S. 548ff. 1256 Schröder, Straßen- und Häuserkampf (20.10.1927), S. 489 f. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 365 fel daran lassen konnte, dass die oben zitierte Passage für ihn ein reines ‚Lippenbekenntnis‘ war, an das er sich nicht gebunden fühlte. Vielmehr vertrat der Autor in seinem Beitrag fast durchgängig Positionen, die sehr viel eher in ein Handbuch für Militäreinsätze gepasst hätten. Die entsprechenden Passagen waren so zahlreich, dass sie an dieser Stelle nur höchst unvollständig wiedergegeben bzw. angedeutet werden können. So lehnte er beispielsweise bei gewaltsamen polizeilichen Großlagen jede Einmischung der Politik oder von „vorgesetzten Behörden“ komplett ab, wobei er insbesondere festhielt: „Am schlimmsten aber [ist es], wenn, ehe der Kampf für die Regierung siegreich beendet ist, Verhandlungen mit den Aufrührern angefangen oder geduldet werden. […] Geht eine Regierung drauf ein, dann ist sie verloren […].“1257 Dass diese Feststellung in eklatantem Widerspruch zu dem von ihm noch kurz zuvor, auf der gleichen Seite geforderten „Vermeiden jedes unnötigen Blutvergießens“ stand, schien den Autor nicht weiter zu stören, dürfte den Lesern dieses Beitrags aber sicherlich nicht entgangen sein. Noch deutlicher wurden die Widersprüche dann im weiteren Verlauf, beispielsweise in der folgenden Schilderung des von Karl Schröder als zweckmäßig erachteten Vorgehens der Polizei bei Straßenkämpfen: „Der eigentliche Angriff wird durch Stoßtrupps geführt, die in der vorhin geschilderten Weise auf der Straße und durch die Höfe sich vorarbeiten. Rücksichtsloses Herangehen bis zum Kampf mit der blanken Waffe und der Handgranate ist ihre Aufgabe. […] Durch Bekanntmachung vorher oder durch Zuruf sind die Einwohner zu veranlassen, ihre Fenster zu schließen; auf jedes offene Fenster ist rücksichtslos zu schießen.“1258 Hatte der Autor zu Beginn, in der weiter oben zitierten Passage noch angemerkt, dass sich die Polizei gerade dadurch vom Militär unterscheide, dass das Militär ein „rücksichtsloses Bekämpfen des Feindes“ anstrebe, wohingegen die Polizei nicht nur auf unbeteiligte Bürger und ihr Eigentum, sondern sogar auf „irregeleitete Volksgenossen“ Rücksicht nehme, so forderte er hier nun explizit, dass die Polizei „rücksichtslos“ vorgehen sollte – und zwar nicht nur gegen Aufständische, sondern auch gegen jeden, der aus irgendeinem Grund seine Fenster nicht rechtzeitig schloss. Zudem verdeut- 1257 Schröder, Straßen- und Häuserkampf (20.10.1927), S. 490. 1258 Schröder, Straßen- und Häuserkampf (5.11.1927), S. 519. IV. Die deutsche Polizei in der Zwischenkriegszeit 366 lichte die eindeutig an militärischen Grundsätzen orientierte sprachliche Ausgestaltung des Beitrags mit Formulierungen wie „Stoßtrupps […], die […] sich vorarbeiten“, dass der Autor keinesfalls streng zwischen militärischen und polizeilichen Mitteln bei Bekämpfung solcher Unruhen unterschied, sondern vielmehr militärische Grundsätze in nahezu unveränderter Form auf die Polizei übertrug. Dies zeigte sich schließlich auch in den folgenden, letzten beiden Sätzen seines Beitrags, mit denen er noch einmal betonen wollte, welcher Faktor seiner Ansicht besonders wichtig für den polizeilichen Erfolg bei solchen Einsätzen war: „Die Hauptsache aber ist der Geist, der die Polizei beseelt. Unbedingte Pflichttreue, selbstlose Hingabe, wenn nötig bis zum Tode, und auf Vertrauen begründeter, nie wankender Gehorsam gegen die Führer sichern allein einen Erfolg.“1259 Spätestens angesichts dieses eindeutigen Plädoyers für militärische Disziplin bei der polizeilichen Bekämpfung von gewaltsamen Unruhen dürfte jedem aufmerksamen Leser seines Beitrags klar geworden sein, dass der von Karl Schröder zu Beginn des Aufsatzes propagierte ‚himmelweite‘ Unterschied1260 zwischen der polizeilichen und militärischen Bekämpfung von gewaltsamen Unruhen nicht nur kein solcher war, sondern dass der Autor geradezu für eine gegenteilige Auffassung stand. Die politische Diversität innerhalb der deutschen Polizei und auch der Polizeiführung verdeutlichte dann wiederum ein Beitrag, der in der ZDPol unmittelbar im Anschluss an Karl Schröders Aufsatz – auf derselben Seite wie die eben zitierte Passage – folgte. In diesem beschäftigte sich der Polizeimajor Kurt Gaudlitz mit einem polizeilichen Einsatz, der sich dem Titel des Beitrags entsprechend gegen „[den] ‚Terror‘ während des letzten Streiks im Niederlausitzer Braunkohlegebiet“ richtete, der sich im Oktober 1927 angeblich ereignet hatte.1261 Dabei kann vorweggenommen werden, dass die Anführungsstriche in diesem Titel dahingehend zu interpretieren waren, dass es sich nach Ansicht des Autors eigentlich gar nicht um ‚Terror‘ gehandelt hatte. Der Streik stellte zwar eine ‚klassische‘ polizeiliche Großlage dar, die einen umfassenden Polizeieinsatz erforderlich machte, allerdings lief dieser weitgehend gewaltlos ab, so dass die Bezeichnung 1259 Schröder, Straßen- und Häuserkampf (20.11.1927), S. 551. 1260 Vgl. Schröder, Straßen- und Häuserkampf (20.10.1927), S. 489 f. 1261 Vgl. K. Gaudlitz, Der ‚Terror‘ während des letzten Streiks im Niederlausitzer Braunkohlegebiet, in: ZDPol, 24. Jg. (1927); Nr. 22 (20.11.1927), S. 551 f. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 367 ‚Terror‘ in diesem Zusammenhang unangebracht war. Dies stellte er auch im ersten Satz seines Beitrags unmissverständlich fest: „Wenn ich in nachstehenden Zeilen zu dem Ergebnis komme, daß beim Oktoberstreik im Niederlausitzer Braunkohlerevier von Terror im großen und ganzen keine Rede sein kann, sondern daß im allgemeinen die gesetzlichen Schranken innegehalten worden sind, so soll damit nicht gesagt sein, daß der erhebliche Einsatz von Polizei unnütz gewesen wäre. Die Polizei muß überall dort, wo in der Öffentlichkeit in Erscheinung tretende große Bewegungen bestehen, rechtzeitig und in ausreichender Stärke vertreten sein.“1262 Interessant war dieser Aufsatz nicht, weil der entsprechende Einsatz aus polizeilicher Sicht besonders schwierig war oder weil besonders innovative Einsatztaktiken angewandt wurden. Vielmehr deutet schon die Tatsache, dass man in der historischen Literatur kaum Hinweise auf diesen Streik findet, darauf hin, dass dieser nicht von überregionaler Bedeutung war und vermutlich auch nicht besonders gewaltsam ablief. Bemerkenswert war vielmehr die Tatsache, dass ein Angehöriger des Polizeioffizierskorps in einem Beitrag in einer der führenden polizeilichen Fachzeitschriften im Zusammenhang mit einem Polizeieinsatz anlässlich eines Streiks nicht nur relativ deutlich Kritik an der Arbeitgeberseite äußerte, sondern darüber hinaus sogar erstaunlich viel Verständnis für die streikende Arbeiterschaft, die ohne jeden Zweifel in hohem Maße mit dem Kommunismus sympathisierten, erkennen ließ. Dabei erläuterte Kurt Gaudlitz zunächst sein Verständnis von den tatsächlichen Machtverhältnissen bei Arbeitskämpfen sowie der Rolle der Polizei im Zusammenhang mit Streiks: „So gut wie es nicht bewiesen zu werden braucht, daß die Arbeitgeberseite mit der großen Macht, die das Großkapital, der Besitz nicht nur der Produktionsmittel, sondern in den Grubenbezirken auch der ganzen Wohnorte selbst, verleiht, einen möglichst starken Druck auf die Streikenden auszuüben sucht, so bedarf es auch keines Beweises, daß die Streikenden mit allen Mitteln einen möglichst großen Gegendruck ausüben. Beide Seiten werden in der Anwendung ihrer Kampfmittel durch das Gesetz beschränkt. Das Auge des Gesetzes, die Polizei, macht diese Beschränkung effektiv. Gegen sie richten sich daher An- 1262 Gaudlitz, Der ‚Terror‘ während des letzten Streiks (20.11.1927), S. 551. IV. Die deutsche Polizei in der Zwischenkriegszeit 368 klagen von beiden Seiten. Die Arbeitgeberseite klagt an, den Terror nicht beseitigt zu haben.“1263 Wie die eben zitierte Passage verdeutlichte, hatte der Autor keine Zweifel an der grundsätzlichen Legitimität von Streiks, solange die beteiligten Parteien die ‚Spielregeln‘, d. h. die gesetzlichen Rahmenbedingungen, einhielten. Die Polizei sollte dabei keine Partei bevorzugen, sondern lediglich als eine Art ‚Schiedsrichter‘ fungieren und die Einhaltung der entsprechenden gesetzlichen Regeln überwachen. Im letzten Satz deutete der Autor nun aber an, dass die Arbeitgeberseite sich darüber beklagen würde, dass die Polizei dabei versagt hätte, die Arbeitnehmerseite in die gesetzlich vorgegebenen Schranken zu weisen. Dies hätte nach Ansicht der Arbeitgeberseite zur Folge gehabt, dass die streikenden Arbeiter „Terror“ ausüben und dadurch Arbeitswillige von ihrer Arbeitsstätte fernhalten konnten. Dieser Vorwurf, der wohl auch in den Medien („Tageszeitungen“) publiziert worden war, dürfte der Polizeiführung im Allgemeinen und dem Autor im Besonderen nicht gefallen haben, was sicherlich auch der Grund für die Publikation dieses Beitrags war. Kurt Gaudlitz hielt den Vorwurf für konstruiert, was er insbesondere damit begründete, dass zum einen keine „Anzeigen in nennenswertem Umfang“ erstattet und zum anderen auch keine gewaltsamen Unruhen von der Polizei festgestellt wurden: „Wenn man mit einem Kraftwagen durch das Grubengebiet fuhr, – also völlig überraschend auftauchte – konnte man nichts von Unruhe oder Ausschreitungen wahrnehmen […].“1264 Dass sein Aufsatz eine Art ‚Gegendarstellung‘ zu der in den Tageszeitungen publizierten Kritik an der polizeilichen Handhabung des Streiks bzw. eine Richtigstellung der von den Betriebsleitern des Grubenbezirks gesteuerten Schilderungen darstellte, verdeutlichte vor allem die folgende Passage: „Der Terror, wie ihn die Tageszeitungen schilderten, soll dahin gegangen sein, daß die vorhandenen sehr zahlreichen Arbeitswilligen (50 Prozent, also viele Tausende) sich nicht getrauen konnten, nach der Arbeitsstätte zu gehen. Ich habe bereits oben erwähnt, daß diesbezügliche Feststellungen oder Anzeigen in nennenswertem Umfange nicht vorliegen. Wenn die Arbeitgeberseite solche Behauptungen als Taktik 1263 Gaudlitz, Der ‚Terror‘ während des letzten Streiks (20.11.1927), S. 551. 1264 Gaudlitz, Der ‚Terror‘ während des letzten Streiks (20.11.1927), S. 552. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 369 aufstellt, braucht man das nicht tragisch zunehmen. Jeder Kämpfer hat seine Taktik.“1265 Vor allem die Bezeichnung der seiner Einschätzung nach unzutreffenden Schilderungen der Grubendirektoren bzw. der Tageszeitungen als „Taktik“ dürfte der Leserschaft seines Beitrags verdeutlicht haben, dass der Polizeimajor durchaus von einer bewusst übertriebenen oder sogar verfälschten Darstellung und damit von einer absichtlichen Täuschung der Öffentlichkeit durch die Arbeitgeberseite ausging. Diese hielt er zwar insofern für nicht „tragisch“, als die Arbeitnehmerseite sich ähnlicher Taktiken bediente und ebenfalls unzutreffende Informationen verbreitete. Allerdings zwang ihn die seiner Meinung nach ungerechtfertigte Kritik der Arbeitgeberseite an der Polizei nun zu einer Richtigstellung und damit zu öffentlicher Kritik an der Grubenleitung. Diese Kritik relativierte der Autor dann allerdings, indem er anführte, dass die Grubendirektoren sich möglicherweise geirrt und die Arbeitswilligkeit der Belegschaft aufgrund der ihnen vorliegenden, unzutreffenden Informationen falsch eingeschätzt hätten, weil große Teile der Arbeiterschaft „‚Terror‘ vorgeschoben“1266 hätten, um Risiken zu vermeiden und ihre wahren Beweggründe – vermutlich die Unterstützung der Streikziele – nicht gegenüber ihrem Arbeitgeber offenlegen zu müssen. Gleichwohl fiel die Kritik der Polizeiführung am Verhalten der Arbeitgeber während des Streiks trotz dieser Relativierungen erstaunlich deutlich aus. Diese Kritik war offensichtlich so deutlich, dass es die Arbeitgeberseite für erforderlich hielt, eine Erwiderung auf den Beitrag von Kurt Gaudlitz zu schreiben und in der ZDPol zu veröffentlichen. Dieser unter der Autorenschaft des Niederlausitzer Bergbauvereins – einem die Interessen der Niederlausitzer Braunkohlewerke vertretenden Ableger des Deutschen Braunkohlen-Industrie-Vereins1267 – publizierte Beitrag erschien knapp zwei Monate später, im Januar 1928.1268 War schon der eben zitierte Beitrag von Kurt Gaudlitz durch eine bemerkenswert deutliche Form der 1265 Gaudlitz, Der ‚Terror‘ während des letzten Streiks (20.11.1927), S. 552. 1266 Gaudlitz, Der ‚Terror‘ während des letzten Streiks (20.11.1927), S. 552. 1267 Vgl. M. Baxmann, Wasser für das Niederlausitzer Industriegebiet – Zum Bau des ersten zentralen Wasserversorgungssystems in der Niederlausitz, in: G. Bayerl, N. Fuchsloch, T. Meyer [Hrsg.], Umweltgeschichte: Methoden, Themen, Potentiale, Münster u. a. 1996, Fußnote 19 auf S. 224. 1268 Vgl. Niederlausitzer Bergbauverein, Der ‚Terror‘ während des Streiks im Niederlausitzer Braunkohlengebiet – Eine Erwiderung auf den Artikel des Pol.- Maj. Gaudlitz, in: ZDPol, 25. Jg. (1928), Nr. 1 (5.1.1928), S. 5 f. IV. Die deutsche Polizei in der Zwischenkriegszeit 370 Kritik von Seiten der Polizei an der Arbeitgeberseite gekennzeichnet, so war die in der Erwiderung des Niederlausitzer Bergbauvereins geäußerte Kritik der Grubenleiter an der Polizei in einer noch deutlicheren und schärferen Form formuliert. Der Aufsatz der Arbeitgeberseite ließ sich auf die Kernaussage reduzieren, dass sämtliche Einschätzungen von Kurt Gaudlitz falsch seien, weil sich die Polizei von den streikenden Arbeitern habe täuschen lassen: „Wir bezweifeln nicht, daß der Verfasser [Kurt Gaudlitz] gutgläubig das wiedergegeben hat, was er sah. Aber es sind ihm seitens der vorzüglich arbeitenden Streikleitung und der gut instruierten Streikposten wohl Potemkimsche [sic] Dörfer vorgezaubert worden.“1269 Im weiteren Verlauf wurden dann sämtliche von Kurt Gaudlitz in seinem Beitrag angeführten Argumente nacheinander aufgegriffen und widerlegt bzw. in Frage gestellt, indem beispielsweise darauf hingewiesen wurde, dass er sich „irrt, wenn er glaubt, in den Grubenorten sei von der Arbeitgeberseite ein starker Druck auf die Streikenden auszuüben versucht worden“, dass er wichtige Aspekte „vergißt“ bzw. „vergißt […] hinzuzufügen“, dass bestimmte Argumente ein „Irrtum von ihm“1270 und seine Angaben „unzutreffend“ oder „unrichtig“1271 seien. Indirekt wurde der Polizeimajor auch der Lüge bezichtigt, da zu den von ihm nicht erwähnten Aspekten die Information gehörte, dass „[s]elbst Landjäger […] in der Dunkelheit von ihren Fahrrädern geholt [wurden], da man in ihnen Arbeitswillige vermutete“1272. Die Nichterwähnung einer so wesentlichen Angabe konnte kaum auf die Vergesslichkeit des Polizeimajors zurückzuführen sein. Dementsprechend zielte ein Großteil des Beitrags offensichtlich darauf ab, Kurt Gaudlitz entweder als naiv, einfältig oder unehrlich zu entlarven. Dass eine solche Charakterisierung eines Polizeimajors bei der aus Polizeibeamten und auch Angehörigen des Polizeioffizierskorps bestehenden Leserschaft nicht gerade auf ungeteilte Zustimmung gestoßen sein dürfte, erscheint wahrscheinlich. Der Beitrag ging aber noch weiter, indem auch die Leistung der Polizei bei diesem Einsatz insgesamt in Frage gestellt wurde: 1269 Niederlausitzer Bergbauverein, Der ‚Terror‘ während des Streiks (5.1.1928), S. 5. 1270 Niederlausitzer Bergbauverein, Der ‚Terror‘ während des Streiks (5.1.1928), S. 5. 1271 Niederlausitzer Bergbauverein, Der ‚Terror‘ während des Streiks (5.1.1928), S. 6. 1272 Niederlausitzer Bergbauverein, Der ‚Terror‘ während des Streiks (5.1.1928), S. 5. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 371 „Leider war die Polizei nicht in der Lage, ‚die Beschränkung, die das Gesetz in der Anwendung der Kampfmittel den Parteien auferlegt, effektiv zu machen‘, da die wenigen Landjäger bei ihrer Ausrüstung angesichts der Überzahl der Streikenden gar nicht in der Lage waren, gegen die Streikenden vorzugehen. […] Die Arbeitswilligen hatten eben in dem 8 tägigen Streik ihre Erfahrungen gemacht und wußten, wie wenig der einzelne in seiner Wohnung und auf dem Wege zum Sammelplatze von der Anwesenheit der Polizei im Revier Nutzen ziehen konnte.“1273 Die in diesen beiden Sätzen enthaltenen, an die Polizei gerichteten Vorwürfe, dass sie die Einhaltung der Gesetze nicht gewährleisten und die Arbeitswilligen nicht schützen konnte, stellte eine so deutliche und gravierende Kritik am betreffenden Polizeieinsatz dar, dass sie von den Lesern des Beitrags auch als Infragestellung der Leistungsfähigkeit der Polizei im Allgemeinen verstanden worden und auf erhebliche Ablehnung gestoßen sein dürfte. Dass eine solche Kritik überhaupt in einer der führenden polizeilichen Fachzeitschriften publiziert werden konnte, war aber sicherlich auch ein Indiz dafür, dass die Schriftleitung der ZDPol Anfang des Jahres 1928 die Meinungs- und Pressefreiheit offensichtlich sehr ernst nahm. Sie deutete aber insbesondere darauf hin, dass die Beziehungen zwischen der Polizei, der Arbeiterklasse und der Großindustrie in den ‚ruhigen Jahren‘ der Weimarer Republik durchaus komplex und nicht uneingeschränkt mit dem Kerngedanken des konflikttheoretischen Ansatzes der Polizeisoziologie zu vereinbaren waren, dass die Polizei ein überwiegend im Interesse des Großbürgertums agierendes Instrument zur Disziplinierung bzw. Unterdrückung der unteren Gesellschaftsschichten und insbesondere der Arbeiterklasse sei.1274 Vielmehr stützte die eben dargestellte, über die ZDPol ausgetragene Auseinandersetzung zwischen Polizei und Industrievertretern, in der ein Polizeimajor nach einem Polizeieinsatz im Rahmen eines Streiks die Arbeitgeberseite sehr deutlich kritisierte und die streikenden Arbeiter von den an sie gerichteten ‚Terrorvorwürfen‘ freisprach, eher den Kerngedanken des modernisierungstheoretischen Ansatzes der Polizeisoziologie, dass die Polizei ein neutrales, im gesamtgesellschaftlichen Interes- 1273 Niederlausitzer Bergbauverein, Der ‚Terror‘ während des Streiks im Niederlausitzer Braunkohlengebiet – Eine Erwiderung (5.1.1928), S. 5 f. 1274 Vgl. Reiner, The Politics of the Police, S. 47ff.; KNÖBL, Polizei und Herrschaft, S. 58ff. IV. Die deutsche Polizei in der Zwischenkriegszeit 372 se agierendes Instrument staatlicher Herrschaft sei.1275 Gerade im Vergleich zu den in den Anfangsjahren der Weimarer Republik in dieser Zeitschrift veröffentlichten Beiträgen, die nicht nur ein deutlich negativeres Bild der Arbeiterschaft zeichneten, sondern zudem ein rücksichtsloses, an militärischen Maßstäben orientiertes Vorgehen gegen diese propagierten1276, kann dies als weiteres Indiz für eine fortschreitende Zivilisierung der Bewältigung von polizeilichen Großlagen interpretiert werden. Gleichwohl ist zu hinterfragen, inwiefern dieser Zivilisierungsprozess lediglich auf einer mehr oder weniger abstrakten Diskursebene stattfand oder sich tatsächlich im Verhalten der Polizeibeamten im Rahmen von Einsätzen bei Demonstrationen und sonstigen Unruhen niederschlug. Äu- ßerst aufschlussreich ist in diesem Zusammenhang eine nähere Betrachtung des als ‚Blutmai‘ bezeichneten polizeilichen Einsatzes gegen die von der KPD organisierten Demonstrationen am 1. Mai 1929 in Berlin sowie die in den darauf folgenden drei Tagen stattgefundenen Unruhen, über die es eine ganze Reihe von sehr gut fundierten, auf gründlichen Quellenrecherchen basierenden, historischen Studien gibt.1277 Diese Arbeiten zeigen, dass das brutale, militärischen Einsatztaktiken folgende Vorgehen der schwerbewaffneten Schutzpolizeieinheiten gegen die Demonstranten sowie die anschließende, dreitägige, von der Arbeiterschaft als Strafaktion empfundene Durchsuchung der Arbeiterviertel Neukölln und Wedding von massiver, größtenteils unnötiger Polizeigewalt geprägt waren und nach Ansicht von Peter Leßmann-Faust ein „entirely inappropriate behaviour of the police“1278 darstellten. Auffällig war insbesondere der exzessive Schusswaffengebrauch durch die Polizei, der in keinem Verhältnis zu der von den Aufständischen ausgehenden Gewalt stand und den Leon Schir- 1275 Vgl. Knöbl, Polizei und Herrschaft, S. 57 f.; Reiner, The Politics of the Police, S. 40ff. 1276 Vgl. z. B. o. V., Darstellung der Bekämpfung des Aufruhrs (20.4.1921), S. 31ff.; o. V., Erfahrungen und Bemerkungen aus der Bekämpfung des Aufruhrs (5.5.1921), S. 60ff. 1277 Vgl. insb. L. Schirmann, Blutmai Berlin 1929 – Dichtungen und Wahrheit, Berlin 1991, S. 82ff.; Kurz, Blutmai, S. 27ff. Vgl. aber auch P. Leßmann-Faust, ‚Blood May‘: The Case of Berlin 1929, in: R. Bessel, C. Emsley [Hrsg.], Patterns of Provocation: Police and Public Disorder, New York u. a. 2000, S. 11ff.; Bessel, Policing, S. 201 f.; Knatz, Polizei in der Weimarer Republik, S. 47 f.; Liang, Die Berliner Polizei, S. 120ff.; Leßmann-Faust, Die Preußische Schutzpolizei, S. 230ff. 1278 Leßmann-Faust, Blood May, S. 24. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 373 mann daher wohl zu Recht dazu bewegt, in diesem Zusammenhang von einem „Polizeimassaker“1279 zu sprechen. Dementsprechend endeten die Kämpfe mit 32 Toten, bei denen es sich nahezu ausschließlich um Unbeteiligte handelte und von denen nur einer Mitglied einer kommunistischen Organisation war, und ca. 200 Verletzten. Bis auf die Ausnahme eines Mannes, der von einem Polizeiwagen überfahren wurde, waren sämtliche Todesfälle auf Polizeikugeln zurückzuführen. Bei keinem der Toten wurde eine Schusswaffe gefunden. Insgesamt wurden drei Schusswaffenträger verhaftet, von denen aber nur zwei über eine einsatzfähige Pistole verfügten. Auch die Hausdurchsuchungen führten lediglich zur Beschlagnahme von vier weiteren brauchbaren Revolvern. Von den angeblich 51, tatsächlich aber nur 13 verletzten Polizeibeamten erlitt keiner eine Schussverletzung und nur zwei wurden mit Nasenbeinbrüchen sowie einer Augenverletzung in ein Krankenhaus überwiesen. Ein in den Medien genannter, angeblich mit einer Schusswaffe verletzter Polizeibeamter hatte sich bereits am 30. April, d. h. vor dem Beginn der Unruhen – vermutlich bei der Beseitigung einer Ladehemmung – am rechten Zeigefinger verletzt.1280 Vor diesem Hintergrund erscheint die Einschätzung von Christian Knatz, dass man „den Berliner ‚Blutmai‘ 1929 ohne wesentliche Einschränkung als von der Polizei inszenierten Aufstand ohne Aufständische bezeichnen“1281 könnte, als durchaus zutreffend. Die oben angesprochenen Zivilisierungstendenzen bei der Bewältigung von polizeilichen Großlagen waren bei diesem Polizeieinsatz hingegen nicht einmal ansatzweise erkennbar. Dies galt auch für den in der ZDPol am 20. Mai 1929 erschienenen Beitrag des Kommandeurs der Berliner Schutzpolizei Magnus Heimannsberg, der sich mit diesem Polizeieinsatz beschäftigte.1282 In diesem gab der Autor einen durchaus ausführlichen Bericht über die Ereignisse und die polizeilichen Aktivitäten an den betreffenden vier Tagen ab, der allerdings, wenn man ihn mit der vorliegenden historischen Fachliteratur vergleicht, zahlreiche Fehler enthält, die so gravierend waren, dass man ohne jeden Zweifel von einer bewussten Täuschung der Öffentlichkeit ausgehen muss. Dies 1279 Schirmann, Blutmai Berlin 1929, S. 151. 1280 Vgl. Schirmann, Blutmai Berlin 1929, S. 13 f., 80 f., S. 89, S. 174ff., S. 340ff.; Leßmann-Faust, Blood May, S. 18 f. 1281 Knatz, Polizei in der Weimarer Republik, S. 47. 1282 Vgl. M. Heimannsberg, Der 1. Mai und seine Folgeerscheinungen in Berlin, in: ZDPol, 26. Jg. (1929), Nr. 10 (20.5.1929), S. 229ff. IV. Die deutsche Polizei in der Zwischenkriegszeit 374 betraf vor allem die zahlreichen Hinweise des Autors auf den Einsatz von Schusswaffen durch die Aufständischen: „In der Höhe der Prinz-Handjery-Straße setzte plötzlich ein sehr heftiges Feuer aus den Querstraßen und aus den Häusern der Herrmannstraße ein. […] Die vorgehende Polizei wurde dabei aus einem Neubau beschossen […]. Gegen 14 Uhr wurde Wiesen-, Ecke Uferstraße auf Polizeibeamte, die einen Demonstrationszug auflösten, geschossen. […] Der Inspektionsführer Wedding stieß kurze Zeit später mit 10 Revierbeamten auf diese Barrikade und wurde dort mit lebhaftem Feuer von der Barrikade, aus den Fenstern und von den Dächern herab bekämpft. […] Bei der Säuberungsaktion wurden in der Kösliner Straße 13 Personen mit der Waffe in der Hand ergriffen, außerdem wurden 2 Dachschützen, von denen einer sich seiner Schußwaffe nicht mehr rechtzeitig hatte entledigen können, von dem Dache des Hauses Kösliner Stra- ße 10 heruntergeholt. […] Die Posten wurden nunmehr durch Feuer von der Straße, von den Dächern und aus den Fenstern der Herrmannstraße angegriffen. […] Kurz darauf wurde das 220. Polizeirevier von einer größeren Bande überfallen, mit Steinwürfen und Pistolenschüssen beschädigt. […] Es wurden gefunden eine Anzahl Pistolen, einige Jagdgewehre, eine Leuchtpistole, Munition mit abgehackter Spitze, Infanterieseitengewehre, Dolche, Schlagwerkzeug aller Art u. ä. m. Noch während dieser Durchsuchung wurden aus einem Hause in der Prinz- Handjery-Straße einige Schüsse auf Polizeibeamte abgegeben.“1283 Die Ausführungen des Polizeikommandeurs zu den festgenommenen Schusswaffenträgern und zu den beschlagnahmten Waffen weichen derart stark von den oben bereits erwähnten, in den offiziellen Polizeiakten erfassten Angaben ab, dass sie als dreiste Lüge gelten müssen. In Bezug auf den angeblichen Beschuss der Polizei durch Aufständische lässt sich dies nicht mit einer solchen Gewissheit feststellen, da nicht ausgeschlossen werden kann, dass die beteiligten Polizeibeamten in der angespannten Situation die Ereignisse verzerrt wahrnahmen, von der Polizei abgegebene Schüsse versehentlich den ‚Aufständischen‘ zurechneten und nicht bemerkten, dass sie – wie Christian Knatz anmerkt – „drei Tage lang gegen ein Phantom gekämpft hatte[n]“1284. Gleichwohl dürfte der aus Polizeibeamten bestehenden und daher schusswaffen-, gewalt- und demonstrationserfahre- 1283 Heimannsberg, Der 1. Mai und seine Folgeerscheinungen in Berlin (20.5.1929), S. 230ff. 1284 Knatz, Polizei in der Weimarer Republik, S. 48. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 375 nen Leserschaft kaum entgangen sein, dass der vom Autor behauptete massive Schusswaffeneinsatz durch die Aufständischen zu einer erheblichen Anzahl an entsprechenden Verletzungen oder sogar Toten auf Seiten der Polizei hätte führen müssen. Stattdessen stellte dieser aber fest: „Im Verlaufe der Unruhetage wurden insgesamt 51 Polizeibeamte verletzt, hiervon einer durch einen Pistolenschuss durch die rechte Hand, viele durch Würfe von Steinen und schweren Bierseideln, Schläge mit Latten, Schlagringen, Gummiknüppeln und Stöcken, einzelne auch durch Fußtritte, die in rohester Art auf zu Fall gebrachte Beamte ver- übt wurden. Zurzeit befinden sich noch 9 Beamte im Krankenhaus, darunter mehrere mit schweren Gehirnerschütterungen, Nasenbeinbrüchen, schweren Augenverletzungen, Verstauchungen und Knochenbrüchen.“1285 Selbst wenn man davon absieht, dass die meisten Leser dieses Beitrags vermutlich nicht wissen konnten, dass die hier angegebene Anzahl an verletzten und ins Krankenhaus überwiesenen Polizeibeamten massiv – etwa um den Faktor vier – übertrieben und die angeführten Verletzungen größtenteils falsch waren, so musste ihnen doch die mangelnde Plausibilität der Ausführungen auffallen. So deuteten die angeführten Verletzungen selbst für Laien – und erst recht für Polizeibeamte – eindeutig darauf hin, dass die Aufständischen eben nicht mit Schusswaffen, sondern fast ausschließlich mit Steinen und sonstigen Wurfgeschossen gekämpft hatten. Demgegenüber stand der massive Schusswaffeneinsatz der Polizei, die gemäß der Unterlagen im Archiv der Polizei ca. 11.000 Schüsse abgab, davon ca. 8.000 aus Pistolen und ca. 3.000 aus Karabinern oder Maschinenpistolen.1286 Dies hielt Magnus Heimannsberg aber nicht von den folgenden, nicht nur grob irreführenden, sondern angesichts der zahlreichen Unbeteiligten, die von Polizeikugeln verletzt oder sogar getötet wurden, geradezu unverschämten Behauptungen und Schuldzuweisungen ab: „Diese immerhin beträchtliche Anzahl der verletzten Beamten findet ihre Erklärung in dem Bestreben, den Gebrauch der Schußwaffe, solange irgend möglich, zu vermeiden. […] Leider hat die gewissenlose Hetze kommunistischer Agitatoren den Tod von 23 Personen zur Folge gehabt. Von diesen hat ein Teil der Polizei im offenen Kampf gegen- 1285 Heimannsberg, Der 1. Mai und seine Folgeerscheinungen in Berlin (20.5.1929), S. 232. 1286 Vgl. Schirmann, Blutmai Berlin 1929, S. 83. IV. Die deutsche Polizei in der Zwischenkriegszeit 376 übergestanden. Sie haben sich ihr Schicksal selbst zuzuschreiben. Umso bedauerlicher ist der Tod der Unbeteiligten. In welchem Umfangen diese den Waffen der Polizei zum Opfer gefallen sind, muß in jedem einzelnen Falle versucht werden, durch eine Obduktion zu klären. Zum mindesten bei einer der beiden auf einem Balkon tot aufgefundenen Frauen scheint als Ergebnis der Obduktion zweifelsfrei festzustehen, daß sie kommunistischen Dachschützen zum Opfer gefallen sind.“1287 Dass die Polizei versucht haben sollte, „den Gebrauch der Schußwaffe, solange irgend möglich, zu vermeiden“, stellte angesichts von ca. 11.000 von ihr abgegebenen Schüssen und der oben genannten Opferzahlen eine augenscheinliche und bizarre ‚Verdrehung‘ von Tatsachen dar. Dass dies bereits unmittelbar nach den Unruhen auch öffentlich bekannt war, erkennt man daran, dass der „offensichtlich unverhältnismäßig scharfe Einsatz der Schutzpolizei […] in den folgenden Wochen oft Anlaß öffentlicher Kritik war“1288, in der Presse breit diskutiert wurde und schließlich sogar Gegenstand von zwei Untersuchungsausschüssen war.1289 Noch verwerflicher erscheint allerdings der in der oben zitierten Passage deutlich werdende Versuch des Kommandeurs der Berliner Schutzpolizei, die Schuld an der Ereignissen komplett auf die Kommunisten zu schieben und dabei jegliche Selbstkritik zu vermeiden. Der Autor ging dabei sogar so weit, dass er nicht nur die Verantwortung für die gewaltsamen Auseinandersetzungen auf die Kommunisten übertrug, weil diese ja „kommunistische Hetze“ betrieben hatten, was angesichts der aktiven Rolle der KPD bei der Planung der verbotenen Maidemonstrationen nachvollziehbar erscheint, sondern er versuchte zudem, die Täterschaft für die nachweislich durch Polizeikugeln erfolgte Tötung von zwei Unbeteiligten auf „kommunistische Dachschützen“ zu schieben. Dass dem Autor vermutlich bereits beim Schreiben des Beitrags bewusst war, dass dies eine Lüge und zumindest ziemlich unwahrscheinlich war, erkennt man an der paradoxen, offensichtlich in manipulativer Absicht verwendeten sprachlichen Formulierung „scheint […] zweifelsfrei festzustehen“. Wenn man dabei zudem berücksichtigt, dass Magnus Heimannsberg als Kommandeur der Berliner Schutzpolizei nicht etwa ein streng konservativreaktionärer Polizeioffizier war, sondern als „Prototyp des zukünftigen 1287 Heimannsberg, Der 1. Mai und seine Folgeerscheinungen in Berlin (20.5.1929), S. 232. 1288 Liang, Die Berliner Polizei, S. 122. 1289 Vgl. Schirmann, Blutmai Berlin 1929, S. 264ff. 2. Modernisierung, Demokratisierung und Professionalisierung (1924-29) 377 ‚Volksoffiziers‘“ galt, der aus einfachen Verhältnissen stammte, durchaus republikanisch gesinnt und in der Belegschaft sehr beliebt war1290, dann lässt dies erahnen, in welch prekärem Zustand sich die deutsche Polizei im Jahr 1929 befand. Die offensichtlichen und gravierenden Lügen im Zusammenhang mit der polizeilichen Bekämpfung des Berliner ‚Blutmais‘ 1929, die Leon Schirmann als „Mai-Dichtungen“1291 bezeichnet, an denen nicht nur der Autor dieses Beitrags, sondern alle Hierarchieebenen der Polizei beteiligt waren, sowie die faktische Impunität der an den unrechtmäßigen, schwerwiegenden Gewaltexzessen beteiligten Polizeibeamten waren mit den Prinzipien eines demokratischen Rechtsstaates nicht in Einklang zu bringen und dürften sich nicht nur negativ auf die Akzeptanz und Glaubwürdigkeit der Polizei, sondern auch der Regierung und der Staatsform ausgewirkt haben. Sie ermutigten die Polizei, sich bei zukünftigen Großlagen ähnlich gewaltbereit zu verhalten und anschließend die Unwahrheit zu sagen, und führten zu einer weiteren Entfremdung zwischen der Polizei und den unteren Bevölkerungsschichten.1292 Richard Bessel bezeichnet den Berliner ‚Blutmai‘ daher sehr treffend als „[t]he clearest revelation of the failure of the police in Weimar Germany, and the SPD-led Prussian police in particular, to ‚gain the respect and trust of the population‘“1293. Insgesamt deuteten die Ereignisse um den ‚Blutmai‘ 1929 und der Beitrag von Magnus Heimannsberg darauf hin, wie oberflächlich die Spuren waren, die die oben bereits ausführlich angesprochenen Demokratisierungs- und Zivilisierungsprozesse in der deutschen Polizei tatsächlich hinterlassen hatten.1294 Trotz der großen Bemühungen insbesondere der sozialdemokratischen preußischen Landesregierung, aber auch der Reichsregierung, die öffentliche Verwaltung im Allgemeinen und die Polizei im Besonderen in diesen ‚ruhigen‘ Jahren der Weimarer Republik zu demilitarisieren, zu demokratisieren und ein vertrauensvolles Verhältnis zwischen Polizei und Bürger herbeizuführen, zeigte sich hier, dass Mitte des Jahres 1929 bei der Bewältigung von polizeilichen Großlagen das „Repertoire der Ordnungshüter außer Angreifen und Schießen kaum Nuancen aufwies. […] So gesehen war der ‚Blutmai‘ das Menetekel der heraufziehenden fina- 1290 Vgl. Liang, Die Berliner Polizei, S. 176ff. (Zitat: S. 176). 1291 Schirmann, Blutmai Berlin 1929, S. 169. 1292 Vgl. Schirmann, Blutmai Berlin 1929, S. 314ff. 1293 Bessel, Policing, S. 201. 1294 Vgl. Bessel, Militarisierung und Modernisierung, S. 336 f. IV. Die deutsche Polizei in der Zwischenkriegszeit 378 len Staatskrise, in der die mächtige, aber eben auch hilflose und zunehmend in Misskredit gebrachte Polizei kaum etwas ausrichten konnte“1295. Stagnation und Kapitulation (1930-32) Angesichts der nach den ‚ruhigen‘ mittleren Jahren der Weimarer Republik dann ab 1930 wieder deutlich zunehmenden politischen Gewalt und der gravierenden sozioökonomischen Auswirkungen der Weltwirtschaftskrise verwundert es nicht, dass die oben dargestellten Demokratisierungs-, Professionalisierungs- und Modernisierungsbestrebungen in der Polizei spätestens mit dem Übergang in die „Ära der Präsidialkabinette“1296 und der Ernennung von Heinrich Brüning zum Reichskanzler am 30. März 1930 ein jähes Ende fanden und die Polizei aus institutioneller Sicht in eine Phase der Stagnation trat. Ab dem Frühjahr des Jahres 1930 kam es immer öfter zu spektakulären, gegen die staatliche Ordnung gerichteten Protesten und Massenaufmärschen, die teilweise von äußerst gewaltsamen Auseinandersetzungen insbesondere zwischen Nationalsozialisten, Kommunisten und Sozialdemokraten begleitet waren, sowie zu politischen Morden und nationalsozialistischen Übergriffen gegen Juden, die naturgemäß ein polizeiliches Einschreiten zur Folge hatten und die Polizei an ihre Belastungsgrenze und darüber hinaus führten.1297 Im Mittelpunkt dieser Auseinandersetzungen standen zunehmend die Nationalsozialisten bzw. die SA und die SS, die „vielerorts die ‚Straße‘ beherrschten und die staatliche Autorität offen herausforderten“1298, so dass eine allgemeine „Bürgerkriegsatmosphäre“1299 entstand, in der es für die Weimarer Polizei immer schwerer wurde, die öffentliche Ordnung und Sicherheit aufrechtzuerhalten, sie ihre Funktion als Instrument staatlicher Herrschaft zunehmend einbüßte und schließlich vor den Nationalsozialisten kapitulierte.1300 Inso- 3. 1295 Knatz, Polizei in der Weimarer Republik, S. 48. 1296 Thoß, Demokratie ohne Demokraten, S. 125. 1297 Vgl. Niedhart, Deutsche Geschichte, S. 126; Thoß, Demokratie ohne Demokraten, S. 143. 1298 Kolb, Deutschland, S. 201. Vgl. auch Sturm, Weimarer Republik, S. 61; Marcowitz, Weimarer Republik 1929-33, S. 97 f. 1299 Wirsching, Die Weimarer Republik, S. 106. 1300 Vgl. Kohler, The Crisis in the Prussian Schutzpolizei 1930-32, S. 149; Bessel, Policing, S. 202 f.; Schumann, Politische Gewalt, S. 306ff.; Leßmann-Faust, Die Preußische Schutzpolizei, S. 314ff.; Leßmann-Faust, Geschichte der Polizei, S. 25. 3. Stagnation und Kapitulation (1930-32) 379 fern stellten die späten Krisenjahre der Weimarer Republik (1930-32) für die deutsche Polizei eine Phase der Stagnation und der Kapitulation dar. Überlastung durch politische Gewalt Ab 1930 führte die hohe Anzahl an politischen Veranstaltungen und Kundgebungen mit potenziell gewaltsamem Ausgang dazu, dass sich dieser Aufgabenbereich zum Haupttätigkeitsfeld der Polizei entwickelte. „[The police] actually had to apply armed force continuously in daily sorties to separate the combatants in meeting halls, on city squares and along their marching routes.“1301 Solche Überwachungs- und Kontrolltätigkeiten, die Richard Bessel als „thankless task“1302 bezeichnet und in der Regel den Einsatz von Gewalt erforderlich machten, banden nahezu das gesamte verfügbare Polizeipersonal und stellten eine so hohe Arbeitsbelastung dar, dass kaum Spielraum verblieb für andere polizeiliche Aktivitäten und erst recht nicht für interne Reorganisationen oder Reformen.1303 Diese Einsätze stellten nicht nur eine hohe physische Belastung dar, sondern waren auch auf der psychischen Ebene zermürbend, da sich die Polizeibeamten zunehmend mit Drohungen, Beleidigungen, Einschüchterungsversuchen und tätlichen Angriffen, in seltenen Fällen sogar bewaffneten Angriffen mit Tötungsabsicht konfrontiert sahen.1304 Auch wenn die meisten dieser Angriffe wohl von Nationalsozialisten ausgingen, so zeigte nicht zuletzt die als ‚Morde vom Bülowplatz‘ bekannt gewordene Ermordung der Polizeioffiziere Paul Anlauf und Franz Lenck sowie die schwere Verletzung eines weiteren Polizeibeamten unter anderem durch den damaligen Leiter des Parteiselbstschutzes der KPD und späteren Minister für Staatssicherheit in der DDR Erich Mielke am 9. August 1931, dass auch die extreme Linke wenig Respekt vor der Polizei hatte und sich aktiv an ihrer Bekämpfung beteiligte.1305 a) 1301 Liang, The Rise of Modern Police, S. 245. 1302 Bessel, Policing, S. 194. 1303 Bessel, Militarisierung und Modernisierung, S. 330 und S. 343; Bessel, Policing, S. 194 f.; Evans, Polizei, Politik und Gesellschaft, S. 624 f.; Leßmann- Faust, Die Preußische Schutzpolizei, S. 248ff.; Schmidt, Schützen und Dienen, S. 246 f. 1304 Vgl. Leßmann-Faust, Die Preußische Schutzpolizei, S. 251ff.; Schmidt, Schützen und Dienen, S. 273ff. und S. 291ff. 1305 Vgl. H. A. Winkler, Der Weg in die Katastrophe – Arbeiter und Arbeiterbewegung in der Weimarer Republik 1930 bis 1933, Berlin u. a. 1987, S, 391 f.; J. IV. Die deutsche Polizei in der Zwischenkriegszeit 380 Dies belegten auch einige Publikationen, die in diesen Jahren in der ZDPol veröffentlicht wurden. So erschienen regelmäßig kurze Beiträge, die ihrem Charakter nach eher als Meldung bezeichnet werden sollten, in denen gewaltsame Übergriffe gegen Polizeibeamte und ihre oftmals tödlichen Konsequenzen geschildert wurden. In den meisten Fällen – und insbesondere wenn der betroffene Polizeibeamte gestorben war – wurde zudem eine Fotografie des Verstorbenen beigefügt. Ein typisches Beispiel für diese Art von Beitrag wird in Abbildung 15 dargestellt. Wie man erkennen kann, handelte es sich bei dieser im November 1931 veröffentlichten Meldung um eine knappe Schilderung des etwa einen Monat zuvor in Gelsenkirchen erfolgten, tödlichen Angriffs auf den Polizeioberwachtmeister Guido Niederwerfer. Während dieser im Rahmen seines Streifendienstes eine Ruhestörung untersuchte, wurde er von einigen anschließend festgenommenen und wohl auch der Tat überführten Linksradikalen erschossen. Meldung eines im Dienst getöteten Polizeibeamten (Quelle: ZDPol, 28. Jg. (1931), Nr. 22 (20.11.1931), S. 535) Da es sich um einen Beitrag in einer polizeinahen Fachzeitschrift, die nahezu ausschließlich von Polizeibeamten gelesen wurde, handelte, verwun- Abb. 15: von Lang, Erich Mielke – Eine deutsche Karriere, Reinbek 1993, S. 23ff. und S. 219. 3. Stagnation und Kapitulation (1930-32) 381 dert es nicht, dass die „ruchlose Tat“ trotz der Kürze der Darstellungen stark emotionalisiert geschildert wurde, insbesondere indem auf die Kinder des Verstorbenen sowie auf seine „qualvollen Schmerzen“ verwiesen wird. Diese Emotionalisierung kann als Indiz für die angespannte Stimmung unter den Polizeibeamten gesehen werden, die sich nach den relativ ‚ruhigen‘ Jahren bis 1929 nun mit einer Situation konfrontiert sahen, in der sie offensichtlich selbst bei Routinemaßnahmen wie der Untersuchung einer Ruhestörung mit tödlicher Gewalt rechnen mussten. Gerade vor dem Hintergrund der weiter oben ausführlich thematisierten Imageoffensive des Streifendienstes, die nicht zuletzt in zahlreichen Publikationen in der ZDPol von den Beamten sehr vehement Höflichkeit, Freundlichkeit und ‚Milde‘ gegenüber dem Bürger eingefordert hatte, um einen stärkeren Rückhalt der Polizei in der Bevölkerung zu erreichen, dürften solche Angriffe auf Streifenbeamte in hohem Maße Enttäuschung, Wut und auch Verbitterung in der Polizeibeamtenschaft bewirkt haben. Insofern könnten auch die etwas übertrieben wirkenden „mehr als 4000 Personen“, die angeblich an der Beerdigung des getöteten Polizeibeamten teilgenommen haben sollten, sowie ihre Charakterisierung als „gewaltige und spontane Kundgebung“ darauf abgezielt haben, der aus Polizeibeamten bestehenden Leserschaft zu suggerieren, dass sie und ihre Leistungen dennoch von der Bevölkerung geschätzt und gewürdigt wurden. Ein weiteres, allerdings sehr unterschiedlich ausgestaltetes Beispiel für einen gewaltsamen Übergriff gegen einen Streifenbeamten in der ZDPol war der im Juli 1932 vom Berliner Polizeioberleutnant Fritz Träger veröffentlichte Beitrag mit dem Titel „Eine polizeiliche Erfahrung“.1306 In diesem Aufsatz schilderte der Autor auf eine sehr anschauliche und überaus glaubhaft wirkende Art und Weise, wie er am 9. Juni 1932 in Reinickendorf von vier jungen Männern, die seiner Einschätzung nach wohl Kommunisten waren, unter dem Vorwand, dass sie eine angeschossene Person gefunden hätten, in einen Hinterhalt gelockt und dann angegriffen wurde. „Mir wurde sofort klar, daß ich in eine Falle geraten war. Ich versuchte, mich durch einen im Sportkursus gelernten Griff des unerbetenen Reiters zu erwehren, was mir aber nicht gelang, da ich im gleichen Augenblick einige herzlich gemeinte Faustschläge in mein Gesicht erhielt. […] Zu allem Überfluß erhob sich nun auch noch ganz quietschvergnügt der ‚Halbtote‘ und beteiligte sich mit Eifer an der unfreundli- 1306 Vgl. F. Träger, Eine polizeiliche Erfahrung, in: ZDPol, 29. Jg. (1932), Nr. 14 (20.7.1932), S. 345. IV. Die deutsche Polizei in der Zwischenkriegszeit 382 chen Auseinandersetzung. […] Ich hatte nun vier Angreifer, die sich redlich, z. T. sogar mit recht gutem Erfolge, bemühten, mir ihre kommunistischen Ideen einzuhämmern. Ich wehrte mich gegenüber der Übermacht, so wie es sich für einen guten Polizisten geziemt. Doch viele Hunde sind des Hasen Tod. Als es mir doch gelang, in einer unbewachten Sekunde mit der rechten Hand in die Nähe der so sehr herbeigesehnten Pistole zu kommen, erhielt ich von einem dieser unfreundlichen Menschen einen mit voller Wucht geführten Schlag mit einer des Bodens beraubten Selterflasche. Ich erhielt eine starke Hiebbzw. Schnittwunde an der linken Stirnseite, die sich sogar über das linke Augenlid hinwegzog. […] Ich torkelte hilflos mit dem stark blutenden Schädel hin und her, während die feigen Angreifer schleunigst flüchteten.“1307 Die Schilderung zeigte zum einen, dass Streifenbeamte, die anhand ihrer Uniform als solche deutlich zu erkennen waren, im Jahr 1932 wohl damit rechnen mussten, dass sie von politischen Extremisten gezielt und mit massiver, potenziell tödlicher Gewalt angegriffen werden konnten. Zum anderen deutete der von Fritz Träger hier verwendete Sprachstil, der sehr ‚lebendig‘ wirkte und zahlreiche ironische bzw. sarkastische Bemerkungen enthielt, auf eine gewisse Gewöhnung an diese Form von politischer Gewalt hin. Dem Autor dürfte klar gewesen sein, dass sein Text durchaus unterhaltsam und teilweise sogar witzig auf seine Leser wirken würde. Wäre es sein Ziel gewesen, seine Enttäuschung, Empörung oder Wut über diesen Angriff auszudrücken und diese Gefühle möglicherweise auch bei seiner Leserschaft zu wecken, hätte er sicherlich einen anderen, ernsteren Sprachstil gewählt. Dass er dies nicht tat, lässt aber darauf schließen, dass solche Übergriffe gegen Polizeibeamte im Sommer 1932 vermutlich alles andere als eine Seltenheit waren. Auffällig ist dabei, dass die in der ZDPol behandelten gewaltsamen Übergriffe gegen Polizeibeamte stets von Kommunisten ausgingen, was die in der Literatur vertretene Ansicht bestätigt, dass sich die Nationalsozialisten – im Gegensatz zu den Kommunisten – in diesen Jahren bewusst dagegen entschieden, die Polizei direkt anzugreifen.1308 Dies belegte nicht zuletzt ein im August 1931 erschienener, recht ausführlicher Beitrag des am Preußischen Polizei-Instituts tätigen Polizeioberst Georg Poten, in welchem er den Polizeieinsatz während des Stahlhelmtages bzw. Reichsfront- 1307 Träger, Eine polizeiliche Erfahrung (20.7.1932), S. 345. 1308 Vgl. Schmidt, Schützen und Dienen, S. 285 f., S. 291. 3. Stagnation und Kapitulation (1930-32) 383 soldatentages am 30. und 31. Mai 1931 in Breslau erörterte.1309 Die Veranstaltung, an der seinen Angaben zufolge zwischen 120.000 und 150.000 Menschen teilnahmen, wurde von den Verantwortlichen des Stahlhelms angemeldet und von den Behörden unter Auflagen genehmigt. In Bezug auf die Sicherheitslage bei diesem Stahlhelmtag stellte der Autor fest: „Die KPD hatte seit Wochen systematisch gegen die Tagung gehetzt, sie hatte zum ‚Proteststreik gegen den Stahlhelm-Überfall‘ aufgerufen und die Parole ausgegeben: ‚Auf die Straße am 30. und 31. Mai zum Massenprotest gegen die Terror- und Streikbanden des Kapitals‘. Von den Nationalsozialisten hieß es, daß sie die Veranstaltung nicht stören würden, jedoch ihre Sympathie mit dem Stahlhelm demonstrativ, insbesondere durch Sprechchöre, zum Ausdruck bringen würden. Danach mußte die Polizei mit Störungen der Radikalen von links rechnen und dementsprechend ihre Maßnahmen treffen. Tatsächlich ist die Veranstaltung von außen her von keiner Seite gestört worden. Dies mag einerseits den vorbeugenden Maßnahmen der Polizei zu danken sein, andererseits wohl dem Umstande, daß die Massen der Parole der KPD in nennenswertem Umfange nicht nachkamen. Lediglich kleinere Zusammenstöße mit einzelnen, durch abgelegene Straßen gehenden Stahlhelmleuten, haben sich ereignet, bei denen leider auch einige blutige Opfer zu verzeichnen waren. Man wird dies der Polizei nicht zum Vorwurf machen können, denn der Stahlhelm war vorher darauf aufmerksam gemacht worden, daß es nicht möglich sei, jeden einzelnen Stahlhelmmann durch Polizeibeamte begleiten zu lassen und daß es daher zweckmäßig sei, abseits gelegene Quartiere und Lokale nur in geschlossenen Trupps aufzusuchen. Was Störungen durch die Teilnehmer an der Tagung selbst anbetrifft, so sind solche so gut wie gar nicht vorgekommen, da der Stahlhelm sich an die von der Polizei gemachten Auflagen hielt.“1310 Georg Poten machte hier sehr deutlich, wer bei diesem Polizeieisatz die Gegner der Polizei waren und welche Seite die Polizei zu beschützen hatte. Die KPD hatte „gehetzt“ und zu Protesten aufgerufen, so dass die Polizei „Maßnahmen“ gegen die zu erwartenden gewaltsamen Ausschreitungen der Kommunisten ergreifen musste. Dass diese Ausschreitungen letztlich nicht eintraten, hielt der Autor nicht den Linksextremen zu Gute, sondern 1309 Vgl. G. Poten, Der Stahlhelmtag 1931 in Breslau – Ein Beispiel für den Großen Aufsichtsdienst, in: ZDPol, 28. Jg. (1931), Nr. 16 (20.8.1931), S. 371ff. 1310 Poten, Der Stahlhelmtag 1931 in Breslau (20.8.1931), S. 371 f. IV. Die deutsche Polizei in der Zwischenkriegszeit 384 führte dies vielmehr auf die gute Arbeit der Polizei und den fehlenden Rückhalt der KPD in der Bevölkerung zurück. Der Stahlhelm und die Nationalsozialisten hingegen verhielten sich geradezu vorbildlich: Sie ließen sich die Veranstaltung genehmigen, störten den Polizeieinsatz nicht und erfüllten die polizeilichen Auflagen. Und auch bei den von ihm angesprochenen, „kleinere[n] Zusammenstöße[n]“ verzichtete er zwar auf die explizite Benennung der Täter- und Opferseite, allerdings dürfte sein Hinweis, dass die Polizei nicht jeden einzelnen Stahlhelm-Anhänger unter Polizeischutz stellen konnte, von seinen Lesern sicherlich so verstanden worden sein, dass die ‚blutigen Opfer‘ Stahlhelm-Anhänger waren, die auf dem Nachhauseweg von Kommunisten angegriffen wurden. Insofern unterstrichen die Ausführungen in diesem Beitrag nicht nur die weiter oben bereits mehrmals angesprochene Rolle der ‚Kommunisten‘ als klassisches Feindbild der Weimarer Polizei1311, sondern auch die „eigentümliche Zurückhaltung“ der Nationalsozialisten bzw. der SA gegenüber der Polizei, die nach Ansicht von Daniel Schmidt aber „keineswegs den Blick darauf verstellen [darf], dass in ihren Reihen ein tiefsitzender Hass auf die ‚Systempolizei‘ weit verbreitet war, der aber durch die Organisationsdisziplin gezügelt wurde. So verzettelten die SA-Männer sich nicht in ständigen Auseinandersetzungen mit den ‚Schupisten‘, sondern konzentrierten sich voll auf die ‚Marxisten‘ und die Eroberung des öffentlichen Raums.“1312 Aus Sicht der Polizei erleichterte dieses Verhalten zweifelsohne die Bewältigung von polizeilichen Großlagen. Die ohnehin an ihrer Belastungsgrenze arbeitenden Polizeibeamten konnten sich auf eine Konfliktpartei – nämlich die Kommunisten – konzentrieren, vermieden es auf diese Weise, ‚zwischen die Fronten‘ zu geraten, und reduzierten ihre Arbeitsbelastung. Zudem konnte die Polizei das relativ niedrige Ausmaß an politischer Gewalt bei einer solchen Großlage mit weit über 100.000 Teilnehmern gegenüber den politischen Entscheidungsträgern und der Öffentlichkeit zweifellos als Erfolg und Beleg für ihre Leistungsfähigkeit als Instrument staatlicher Herrschaft verbuchen. Dass dies langfristig nicht ohne Auswirkungen auf ihre Sympathie für den Nationalsozialismus und ihren Rückhalt im linken politischen Spektrum und in der Arbeiterschaft bleiben konnte, ist allerdings anzunehmen. 1311 Vgl. Knatz, Polizei in der Weimarer Republik, S. 51; Schmidt, Schützen und Dienen, S. 74 f. und S. 252 f. 1312 Schmidt, Schützen und Dienen, S. 285 f. 3. Stagnation und Kapitulation (1930-32) 385 Gleichwohl darf dies nicht darüber hinweg täuschen, dass die meisten Polizeieinsätze zur Bewältigung von polizeilichen Großlagen in diesen letzten Jahren der Weimarer Republik in der Regel nicht so reibungslos abliefen, sondern äußerst gewaltsam endeten. Der weit überwiegende Teil der politischen Gewalt spielte sich dabei zwischen den Anhängern der links- und rechtsextremen politischen Parteien ab, die politische Versammlungen oder Kundgebungen der jeweils anderen Seite störten oder angriffen. Wie bereits oben angemerkt worden ist, kam der Polizei bei dieser Form des „Versammlungskleinkrieg[s]“ die ‚undankbare‘ Aufgabe zu, die jeweils angegriffene Seite vor der anderen zu schützen, wobei die Rollen so häufig wechselten, dass oftmals nicht klar war, wer der Angreifer und wer der Angegriffene war.1313 Die Polizeibeamten gerieten so in eine zunehmend aussichtslose und frustrierende Lage, die ihre Autorität unterminierte und „am Selbstbewusstsein der Polizisten [fraß]“1314. Als besondere Herausforderung erwies sich hierbei, dass sowohl die KPD als auch die NSDAP bei ihren Auseinandersetzungen mit der Polizei auf neuartige Taktiken zurückgriffen, die die Grenzen der in den Jahren zuvor von der Polizei so erfolgreich zur Niederschlagung von bürgerkriegsähnlichen Aufständen verwendeten militärischen Einsatzkonzeptionen aufzeigten.1315 Hierzu gehörten Scheindemonstrationen, d. h. „Ablenkungsmanöver, die die Polizei in ‚betriebsarme‘ Gebiete lockten“1316, Blitzdemonstrationen, „die sich bereits vor dem Auftauchen der Polizei wieder auflösten“1317, oder der Ein- 1313 Vgl. Schumann, Politische Gewalt, S. 314ff. (Zitat: S. 314); D. Schmidt, Die Straße beherrschen, die Stadt beherrschen – Sozialraumstrategien und politische Gewalt im Ruhrgebiet 1929-1933, in: A. Lüdtke, H. Reinke, M. Sturm [Hrsg.], Polizei, Gewalt und Staat im 20. Jahrhundert, Wiesbaden 2011, S. 225ff. 1314 Schmidt, Die Straße beherrschen, die Stadt beherrschen, S. 244. 1315 Vgl. E. Rosenhaft, Die KPD der Weimarer Republik und das Problem des Terrors in der ‚Dritten Periode‘, 1929-1933, in: W. J. Mommsen, G. Hirschfeld [Hrsg.], Sozialprotest, Gewalt, Terror – Gewaltanwendung durch politische und gesellschaftliche Randgruppen im 19. und 20. Jahrhundert, Stuttgart 1982, S. 400; R. Bessel, Political Violence and the Rise of Nazism – Storm Troopers in Eastern Germany 1925-1934, New Haven 1984, S. 82ff. 1316 A. Dorpalen, SPD und KPD in der Endphase der Weimarer Republik, in: Vierteljahreshefte für Zeitgeschichte, 31. Jg. (1983), S. 94. 1317 M.-L. Ehls, Protest und Propaganda: Demonstrationen in Berlin zur Zeit der Weimarer Republik, Berlin u. a. 1997, S. 297. IV. Die deutsche Polizei in der Zwischenkriegszeit 386 satz von so genannten ‚SA-Bräuten‘, die als „getarnte Waffenverstecke“1318 dienten und so Waffen dem polizeilichem Zugriff entzogen.1319 Die Kreativität der radikalen politischen Parteien bei der Umgehung von gesetzlichen Regelungen wie Versammlungsverboten usw. und die Schwierigkeiten der Polizei, effektiv dagegen vorzugehen, verdeutlichte beispielsweise ein im Mai 1931 in der ZDPol erschienener Beitrag, in dem sich die promovierten Regierungsassessoren Dagobert Arian und Oskar Oesterle mit der praktischen Umsetzung einer der zahlreichen, damals von der Regierung erlassenen Notverordnungen zur Bekämpfung der politischen Gewalt beschäftigten.1320 Ihre Ausführungen ließen erkennen, dass links- und rechtsradikale Gruppierungen Versammlungsverbote dadurch umgingen, dass sie die Polizei über den wahren Charakter von Veranstaltungen täuschten: „Wissenschaftliche Vorträge, Filmvorführungen und Theatervorstellungen werden in der Regel nicht einen solchen [politischen] Zweck erfüllen und damit nicht den Charakter einer Versammlung tragen. Derartige Veranstaltungen können jedoch zur Versammlung werden, wenn bei ihnen die belehrenden und unterhaltenden Zwecke gegen- über dem demonstrativen Charakter und der bewußten Einwirkung auf die öffentliche Meinung in den Hintergrund treten. Dies wird häufiger bei den ‚wissenschaftlichen‘ Vorträgen, Filmvorführungen und Theatervorstellungen der Fall sein, die von rechts- und linksradikalen Parteien veranstaltet werden. Es sei hierbei insbesondere an die rassekundlichen Vorträge der Nationalsozialistischen Deutschen Arbeiterpartei, die Filmvorführungen der Kommunistischen Partei Deutschlands und NSDAP und die Theatervorstellungen der ‚Nationalsozialistischen Volksbühne‘ und der kommunistischen Agitprop-Truppen erinnert. Die Notverordnung bietet auch die Möglichkeit, gegen die in letzter Zeit immer stärker um sich greifende Hofpropaganda der radikalen Parteien vorzugehen, die darin besteht, daß Trupps von fünf bis zehn Mann von Hof zu Hof ziehen, um dort durch Musikaufführun- 1318 T. Balistier, Gewalt und Ordnung: Kalkül und Faszination der SA, Münster 1989, S. 175. 1319 Vgl. Schumann, Politische Gewalt, S. 308; Ehls, Protest und Propaganda, S. 383. 1320 Vgl. D. Arian, O. Oesterle, Praktische Winke zur Durchführung der Notverordnung, in: ZDPol, 28. Jg. (1931), Nr. 9 (5.5.1931), S. 193 f. 3. Stagnation und Kapitulation (1930-32) 387 gen und vornehmlich durch Sprechchöre und kurze Ansprachen das Feindesland zu bearbeiten.“1321 Die Autoren, die offensichtlich bestens mit diesen Formen der politischen Werbung vertraut waren, erläuterten hier nicht nur auf einer juristisch-abstrakten Ebene, wann eine politische Versammlung im Sinne der Notverordnung vorlag, sondern wiesen auch auf konkrete Veranstaltungsformate der NSDAP und KPD hin, bei denen regelmäßig von einer Verschleierung ihres politischen Charakters auszugehen sei. Interessant war auch der Hinweis auf die Existenz von Gruppen bzw. „Trupps“, die sich an beiden Enden des politischen Spektrums auf mehr oder weniger künstlerische Formen der politischen Agitation spezialisiert hatten. Da sich eine solche Spezialisierung nur lohnen konnte, wenn entsprechende Aufführungen regelmä- ßig angeboten wurden, ließ sich daraus schließen, dass die Autoren hier nicht von einigen, wenigen Einzelfällen sprachen, sondern vielmehr von einem flächendeckenden Phänomen, das die öffentliche Ordnung und Sicherheit bedrohte und vor dem Erlass der entsprechenden Notverordnung nicht wirksam von der Polizei bekämpft werden konnte. Zugleich ließ sich aber erahnen, dass die Notverordnung kaum geeignet war, die Problemlage dauerhaft zu lösen, da es für die damit konfrontierten Polizeibeamten in der Praxis äußerst schwierig gewesen sein dürfte, im Vorfeld von solchen Veranstaltungen abzuschätzen, ob sie einer extremen politischen Partei zuzurechnen war und inwiefern „die belehrenden und unterhaltenden Zwecke gegenüber dem demonstrativen Charakter und der bewußten Einwirkung auf die öffentliche Meinung in den Hintergrund“ treten würden oder nicht. Wie schwierig die praktische Umsetzung solcher Regelungen durch die Polizei war, deuteten beispielsweise die folgenden Ausführungen zu der Frage, wann eine Veranstaltung als ‚politisch‘ oder als ‚öffentlich‘ zu gelten habe, an: „Nicht unter den Begriff des ‚Politischen‘ fallen hiernach grundsätzlich Veranstaltungen der Gewerkschaften […]. Diese Ablehnung des politischen Charakters gilt jedoch nicht für solche Fälle, in denen die Gewerkschaften ausdrücklich zu politischen Fragen Stellung nehmen. […] ‚Öffentlich‘ ist eine Versammlung, wenn ein nicht bestimmt abgegrenzter Personenteil Zutritt hat. Veranstaltungen, in denen Mitglieder mit Gästen erscheinen können oder in denen ‚Gäste willkommen‘ sind, werden in der Regel als öffentliche anzusprechen sein. Lediglich 1321 Arian, Oesterle, Praktische Winke (5.5.1931), S. 193. IV. Die deutsche Polizei in der Zwischenkriegszeit 388 in den Fällen, in denen tatsächlich eine besondere Auswahl der Gäste erfolgt, sind solche Versammlungen nicht öffentlich.“1322 Diese aus juristischer Sicht nachvollziehbaren, korrekten und sicherlich auch zweckmäßigen Abgrenzungen der offensichtlich juristisch vorgebildeten Autoren dieses Beitrags dürften für die aus Polizeibeamten bestehende Leserschaft allerdings nur von begrenztem praktischem Nutzen gewesen sein. So dürften die zuständigen Polizeibeamten angesichts der Verschleierungstaktiken der KPD und NSDAP kaum in der Lage gewesen sein, zuverlässig abschätzen, ob im Rahmen einer geplanten Veranstaltung tatsächlich „zu politischen Fragen Stellung“ genommen oder eine „besondere Auswahl der Gäste“ vorgenommen werden würde. Zudem dürfte eine flächendeckende, effektive Kontrolle dieser Veranstaltungen mit den vorhandenen personellen Ressourcen der Polizei kaum möglich gewesen sein. Gleichwohl war die Polizei an die geltende Rechtslage gebunden und musste daher dieses weitgehend aussichtlose Unterfangen in Angriff nehmen. Langfristig bestand unter diesen Rahmenbedingungen allerdings die Gefahr einer massiven Überforderung der Polizei und einer zunehmenden Frustration der Polizeibeamtenschaft. Die nahezu täglich stattfindenden gewaltsamen Auseinandersetzungen zwischen Links- und Rechtsextremen im Rahmen von ‚Saalschlachten‘ oder Angriffen auf politische Gegner bei öffentlichen Kundgebungen oder im Anschluss an politische Versammlungen und die damit verbundenen polizeilichen Einsätze fanden in der ZDPol regelmäßig Beachtung. Dabei diente die schwierige Sicherheitslage in der Regel als Einstieg, um anschließend ein spezielles, sich daraus ergebendes Sicherheits- oder Ordnungsproblem oder ein damit zusammenhängendes Ereignis zu erörtern. So publizierte beispielsweise Hans Kolbe, Stadtpolizeidirektor in Cottbus, am 5. März 1931 einen Beitrag, der sich mit der Rolle der kommunalen Polizei bei der Bekämpfung der politischen Gewalt beschäftigte.1323 Darin ging er zunächst auf die schwierige Sicherheitslage in Deutschland ein und stellte hierzu fest: „Die Aufgaben der Polizei haben sich bekanntlich gegen die Vorkriegszeit bedeutend vermehrt, […]. Insbesondere nimmt der Sicherheitsdienst bei öffentlichen Veranstaltungen – besonders bei denen der politischen Parteien – einen breiten Raum ein und stellt an die Polizei 1322 Arian, Oesterle, Praktische Winke (5.5.1931), S. 193 f. 1323 Vgl. H. Kolbe, Die Verwendung von Kommunal-Polizeikräften in Sonderfällen, in: ZDPol, 28. Jg. (1931), Nr. 5 (5.3.1931), S. 99ff. 3. Stagnation und Kapitulation (1930-32) 389 hohe Ansprüche. […] Verschiedene Parteien haben zur Unterstützung ihrer Pläne eigene Unterorganisationen mit militärischem Charakter geschaffen, deren Bezeichnungen, wie Sturmtrupp, Sturmabteilungen, usw., schon auf den Verwendungszweck hinweisen. […] Sie entfalteten nicht nur im Wahlkampf eine intensive Propaganda, sondern es wurden Sturmtrupps gebildet, die die Gegner bei sich bietender Gelegenheit tätlich angriffen, Versammlungen und Umzüge zu sprengen versuchten. Derartige wohl vorbereitete Überfälle wurden in der Wahlvorbereitungszeit im Reiche täglich gemeldet und sind auch jetzt noch häufig an der Tagesordnung. Die Folge ist, daß auch die Polizei selbst über eine wohl organisierte und straff disziplinierte und entsprechend waffentechnisch ausgerüstete Beamtenschaft verfügen muß. Die Schutzpolizei ist dieses geforderte Machtinstrument in der Hand des Staates.“1324 Die Problemanalyse des Autors identifizierte die (para-) militärisch organisierten Kampfverbände einiger politischer Parteien als wichtigstes Instrument der politischen Gewalt. Dabei verzichtete er zwar auf eine namentliche Benennung der gemeinten Verbände, allerdings dürfte für die aus Polizeibeamten bestehende Leserschaft kein Zweifel daran bestanden haben, dass es sich hierbei insbesondere um die SA und den RFB handelte. Die Lösung für dieses Problem lag nach Ansicht Hans Kolbes darin, auch auf Seiten des Staates über Einheiten mit entsprechender militärischer Kampfkraft zu verfügen, um die Kampfverbände der links- und rechtsextremen Parteien besiegen zu können. Diese Funktion kam seiner Meinung der Schutzpolizei zu, die er explizit im Sinne des Titels dieser hier vorliegenden Dissertation als „Machtinstrument des Staates“ bezeichnet. Interessant ist hier vor allem die Selbstverständlichkeit, mit der Autor den militärischen Charakter der Schutzpolizei betonte, was die weiter oben behandelte These belegt, dass die 1920 von der Interalliierten Militär-Kontrollkommission in der ‚Boulogner Note‘ geforderte Abschaffung der militärisch geprägten Sicherheitspolizei strenggenommen nicht stattfand, sondern „daß diese, mit dem neuen Namen ‚Schutzpolizei‘ versehen […], weiterbestand“1325 und zehn Jahre später auch ganz offen so in der führenden polizeinahen Fachzeitschrift charakterisiert werden konnte. An diesem militärischen Charakter hatten auch die Demokratisierungs-, Modernisierungs- 1324 Kolbe, Die Verwendung von Kommunal-Polizeikräften in Sonderfällen (5.3.1931), S. 99. 1325 Leßmann-Faust, Die Preußische Schutzpolizei, S. 92. IV. Die deutsche Polizei in der Zwischenkriegszeit 390 und Professionalisierungsbemühu